![Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677] - Staining of human cerebral cortex, kidney, lymph node and testis using Anti-NSFL1C antibody NBP2-13677 (A) shows similar protein distribution across tissues to independent antibody NBP2-13676 (B).](http://images.novusbio.com/fullsize/NSFL1C-Antibody-Immunohistochemistry-Paraffin-NBP2-13677-img0005.jpg "Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677] - Staining of human cerebral cortex, kidney, lymph node and testis using Anti-NSFL1C antibody NBP2-13677 (A) shows similar protein distribution across tissues to independent antibody NBP2-13676 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: EEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVDDLFKGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLG |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NSFL1C |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot Syntaxin-BP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin-BP1_AF5675_Western_Blot_5803.jpg)
![Immunohistochemistry Syntaxin-BP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin-BP1_AF5675_Immunohistochemistry_7192.jpg)
![Knockout Validated Syntaxin-BP1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af5675_human-mouse-rat-syntaxin-bp1-affinity-purified-polyclonal-ab-knockout-validated-2410202414339.png)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
| Publications using NBP2-13677 | Applications | Species |
|---|---|---|
| Mirsanaye A, Hoffmann S, Weisser M et al. VCF1 is an unconventional p97/VCP cofactor promoting recognition of ubiquitylated p97-UFD1-NPL4 substrates bioRxiv 2023-07-26 (IP) Details: 0.5 µg/sample |
IP | |
| Shearer RF, Typas D, Coscia F et al. K27-linked ubiquitylation promotes p97 substrate processing and is essential for cell proliferation The EMBO journal 2022-05-02 [PMID: 35349166] (WB, ICC/IF, Human) | WB, ICC/IF | Human |
| Wang K Z Q, Steer E et al. PINK1 Interacts with VCP/p97 and Activates PKA to Promote NSFL1C/p47 Phosphorylation and Dendritic Arborization in Neurons. Eneuro 2019-02-21 [PMID: 30783609] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NSFL1C |
![Western Blot: NSFL1C Antibody [NBP2-13677] - PINK1 phosphorylates the activation loop of PKA. Immunoprecipitation products of HEK293 cell lysates expressing GFP or PINK1-GFP reveal that PINK1 pulls down the PKA holoenzyme (PKAcat and PKAreg) in addition to VCP and NSFL1C. Image collected and cropped by CiteAb from the following publication (//eneuro.org/lookup/doi/10.1523/ENEURO.0466-18.2018), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/NSFL1C-Antibody-Western-Blot-NBP2-13677-img0011.jpg "Western Blot: NSFL1C Antibody [NBP2-13677] - PINK1 phosphorylates the activation loop of PKA. Immunoprecipitation products of HEK293 cell lysates expressing GFP or PINK1-GFP reveal that PINK1 pulls down the PKA holoenzyme (PKAcat and PKAreg) in addition to VCP and NSFL1C. Image collected and cropped by CiteAb from the following publication (//eneuro.org/lookup/doi/10.1523/ENEURO.0466-18.2018), licensed under a CC-BY license.")
![Immunocytochemistry/Immunofluorescence: NSFL1C Antibody [NBP2-13677] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/NSFL1C-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13677-img0004.jpg "Immunocytochemistry/Immunofluorescence: NSFL1C Antibody [NBP2-13677] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677] - Staining of human testis.](http://images.novusbio.com/fullsize/NSFL1C-Antibody-Immunohistochemistry-Paraffin-NBP2-13677-img0010.jpg "Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677] - Staining of human testis.")
![Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677] - Staining of human kidney.](http://images.novusbio.com/fullsize/NSFL1C-Antibody-Immunohistochemistry-Paraffin-NBP2-13677-img0007.jpg "Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/NSFL1C-Antibody-Immunohistochemistry-Paraffin-NBP2-13677-img0008.jpg "Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677] - Staining of human lymph node.](http://images.novusbio.com/fullsize/NSFL1C-Antibody-Immunohistochemistry-Paraffin-NBP2-13677-img0009.jpg "Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677] - Staining of human lymph node.")
![Western Blot: NSFL1C Antibody [NBP2-13677] - Analysis in human cell line A-549.](http://images.novusbio.com/fullsize/antibody/nbp2-13677_rabbit-polyclonal-nsfl1c-antibody-western-blot-3420249306..jpg "Western Blot: NSFL1C Antibody [NBP2-13677] - Analysis in human cell line A-549.")
![Western Blot: NSFL1C Antibody [NBP2-13677] - PINK1 phosphorylates the activation loop of PKA. A, IP products of HEK293 cell lysates expressing GFP or PINK1-GFP reveal that PINK1 pulls down the PKA holoenzyme (PKAcat & PKAreg) in addition to VCP & p47. B, IP products of HEK293 lysates expressing PINK1-GFP, GFP or GFP-VCP reveal that either PINK1 or VCP pull down p47, but only PINK1 pulls down PKAreg. C, IP products of HEK293 lystates expressing Vector or MYC-p47 reveals that p47 does not interact w/ PKAcat or PKAreg. D, 2-D analysis of endogenous PKA subunits in control (M14) & PINK1-3xFlag (#24) stable SH-SY5Y lines reveal an acidic shift of PKAcat (arrow), but not PKAreg, in PINK1-overexpressing cells. E, Structural model for the MD-equilibrated (100 ns) complex between hPINK1 (pink) & PKAcat (green). PKA-T197 (cyan balls) & PINK1-D362 (orange balls) are shown in relation to PINK1-bound ATP w/ two Mg2+ (purple). Red, tan, white, cyan, & blue represent O, P, H, C, & N atoms, respectively, of ATP. F, Immunoblot analysis of HEK293 cells transfected w/ GFP or PINK1-GFP reveals that PINK1-GFP increases PKAcat phosphorylation at T197, but has no effect on PKAreg phosphorylation at S99 (mean ± SD, three independent experiments, p = 0.014). G, Recombinant PKAcat purified from E. coli, which is already phosphorylated at T197, dephosphorylated by incubation w/ lambda phosphatase (PP) at 30°C × 1 h. Successful dephosphorylation verified by immunoblot. H, In vitro kinase assay of human GST-PINK1 w/ dephosphorylated recombinant PKAcat in the presence or absence of the PKA inhibitor H89 reveals that hPINK1 phosphorylates PKA at T197. I, In vitro kinase assay of GST-TcPINK1 w/ dephosphorylated recombinant PKAcat reveals that TcPINK1 is also capable of directly phosphorylating PKAcat. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30783609), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-13677_rabbit-polyclonal-nsfl1c-antibody-310202416121970.jpg "Western Blot: NSFL1C Antibody [NBP2-13677] - PINK1 phosphorylates the activation loop of PKA. A, IP products of HEK293 cell lysates expressing GFP or PINK1-GFP reveal that PINK1 pulls down the PKA holoenzyme (PKAcat & PKAreg) in addition to VCP & p47. B, IP products of HEK293 lysates expressing PINK1-GFP, GFP or GFP-VCP reveal that either PINK1 or VCP pull down p47, but only PINK1 pulls down PKAreg. C, IP products of HEK293 lystates expressing Vector or MYC-p47 reveals that p47 does not interact w/ PKAcat or PKAreg. D, 2-D analysis of endogenous PKA subunits in control (M14) & PINK1-3xFlag (#24) stable SH-SY5Y lines reveal an acidic shift of PKAcat (arrow), but not PKAreg, in PINK1-overexpressing cells. E, Structural model for the MD-equilibrated (100 ns) complex between hPINK1 (pink) & PKAcat (green). PKA-T197 (cyan balls) & PINK1-D362 (orange balls) are shown in relation to PINK1-bound ATP w/ two Mg2+ (purple). Red, tan, white, cyan, & blue represent O, P, H, C, & N atoms, respectively, of ATP. F, Immunoblot analysis of HEK293 cells transfected w/ GFP or PINK1-GFP reveals that PINK1-GFP increases PKAcat phosphorylation at T197, but has no effect on PKAreg phosphorylation at S99 (mean ± SD, three independent experiments, p = 0.014). G, Recombinant PKAcat purified from E. coli, which is already phosphorylated at T197, dephosphorylated by incubation w/ lambda phosphatase (PP) at 30°C × 1 h. Successful dephosphorylation verified by immunoblot. H, In vitro kinase assay of human GST-PINK1 w/ dephosphorylated recombinant PKAcat in the presence or absence of the PKA inhibitor H89 reveals that hPINK1 phosphorylates PKA at T197. I, In vitro kinase assay of GST-TcPINK1 w/ dephosphorylated recombinant PKAcat reveals that TcPINK1 is also capable of directly phosphorylating PKAcat. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30783609), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: NSFL1C Antibody [NBP2-13677] - PINK1 phosphorylates the activation loop of PKA. A, IP products of HEK293 cell lysates expressing GFP or PINK1-GFP reveal that PINK1 pulls down the PKA holoenzyme (PKAcat & PKAreg) in addition to VCP & p47. B, IP products of HEK293 lysates expressing PINK1-GFP, GFP or GFP-VCP reveal that either PINK1 or VCP pull down p47, but only PINK1 pulls down PKAreg. C, IP products of HEK293 lystates expressing Vector or MYC-p47 reveals that p47 does not interact w/ PKAcat or PKAreg. D, 2-D analysis of endogenous PKA subunits in control (M14) & PINK1-3xFlag (#24) stable SH-SY5Y lines reveal an acidic shift of PKAcat (arrow), but not PKAreg, in PINK1-overexpressing cells. E, Structural model for the MD-equilibrated (100 ns) complex between hPINK1 (pink) & PKAcat (green). PKA-T197 (cyan balls) & PINK1-D362 (orange balls) are shown in relation to PINK1-bound ATP w/ two Mg2+ (purple). Red, tan, white, cyan, & blue represent O, P, H, C, & N atoms, respectively, of ATP. F, Immunoblot analysis of HEK293 cells transfected w/ GFP or PINK1-GFP reveals that PINK1-GFP increases PKAcat phosphorylation at T197, but has no effect on PKAreg phosphorylation at S99 (mean ± SD, three independent experiments, p = 0.014). G, Recombinant PKAcat purified from E. coli, which is already phosphorylated at T197, dephosphorylated by incubation w/ lambda phosphatase (PP) at 30°C × 1 h. Successful dephosphorylation verified by immunoblot. H, In vitro kinase assay of human GST-PINK1 w/ dephosphorylated recombinant PKAcat in the presence or absence of the PKA inhibitor H89 reveals that hPINK1 phosphorylates PKA at T197. I, In vitro kinase assay of GST-TcPINK1 w/ dephosphorylated recombinant PKAcat reveals that TcPINK1 is also capable of directly phosphorylating PKAcat. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30783609), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-13677_rabbit-polyclonal-nsfl1c-antibody-310202416121987.jpg "Western Blot: NSFL1C Antibody [NBP2-13677] - PINK1 phosphorylates the activation loop of PKA. A, IP products of HEK293 cell lysates expressing GFP or PINK1-GFP reveal that PINK1 pulls down the PKA holoenzyme (PKAcat & PKAreg) in addition to VCP & p47. B, IP products of HEK293 lysates expressing PINK1-GFP, GFP or GFP-VCP reveal that either PINK1 or VCP pull down p47, but only PINK1 pulls down PKAreg. C, IP products of HEK293 lystates expressing Vector or MYC-p47 reveals that p47 does not interact w/ PKAcat or PKAreg. D, 2-D analysis of endogenous PKA subunits in control (M14) & PINK1-3xFlag (#24) stable SH-SY5Y lines reveal an acidic shift of PKAcat (arrow), but not PKAreg, in PINK1-overexpressing cells. E, Structural model for the MD-equilibrated (100 ns) complex between hPINK1 (pink) & PKAcat (green). PKA-T197 (cyan balls) & PINK1-D362 (orange balls) are shown in relation to PINK1-bound ATP w/ two Mg2+ (purple). Red, tan, white, cyan, & blue represent O, P, H, C, & N atoms, respectively, of ATP. F, Immunoblot analysis of HEK293 cells transfected w/ GFP or PINK1-GFP reveals that PINK1-GFP increases PKAcat phosphorylation at T197, but has no effect on PKAreg phosphorylation at S99 (mean ± SD, three independent experiments, p = 0.014). G, Recombinant PKAcat purified from E. coli, which is already phosphorylated at T197, dephosphorylated by incubation w/ lambda phosphatase (PP) at 30°C × 1 h. Successful dephosphorylation verified by immunoblot. H, In vitro kinase assay of human GST-PINK1 w/ dephosphorylated recombinant PKAcat in the presence or absence of the PKA inhibitor H89 reveals that hPINK1 phosphorylates PKA at T197. I, In vitro kinase assay of GST-TcPINK1 w/ dephosphorylated recombinant PKAcat reveals that TcPINK1 is also capable of directly phosphorylating PKAcat. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30783609), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunohistochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunohistochemistry_16919.jpg)
![Immunocytochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunocytochemistry__Immunofluorescence_16973.jpg)
![Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images/af1916_human-p63-tp73l-affinity-purified-polyclonal-ab-41202412401237.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")