Reactivity | Hu, Mu, Fe, RtSpecies Glossary |
Applications | WB, ICC/IF, IHC, KO |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETP |
Predicted Species | Rat (97%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | NKX2-2 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
Theoretical MW | 30 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
Control Peptide |
|
||
Reviewed Applications |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publications using NBP1-82554 | Applications | Species |
---|---|---|
Pasquali L, Gaulton KJ, Rodriguez-Segui SA et al. Pancreatic islet enhancer clusters enriched in type 2 diabetes risk-associated variants. Nat Genet 2014-02-01 [PMID: 24413736] | ||
Fiori JL, Shin YK, Kim W et al. Resveratrol Prevents beta-cell Dedifferentiation in Non-Human Primates Given a High Fat/ High Sugar Diet. Diabetes 2013-07-24 [PMID: 23884882] | ||
Lawson MH, Cummings NM, Rassl DM et al Two novel determinants of EPE resistance in small cell lung cancer Cancer Res 2011-07-01 [PMID: 21642373] | ||
Hall ET, Stewart DP, Dillard M et al. Myosin 10 and a Cytoneme-Localized Ligand Complex Promote Morphogen Transport bioRxiv 2020-01-01 (KO, IF/IHC, Mouse) | KO, IF/IHC | Mouse |
Fujikawa T, Uemura S, Yoshida M et al. Spindle cell sarcoma with KIAA1549 BRAF resembling infantile fibrosarcoma morphologically: A case report and literature review Oncology Letters 2022-11-01 [PMID: 36380878] (IHC-P, Human) | IHC-P | Human |
Images | Ratings | Applications | Species | Date | Details | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
ICC | Feline | 06/23/2017 |
Summary
Comments
|
||||||||||
Enlarge |
reviewed by:
Jason Spaeth |
IHC-Fr | Mouse | 11/09/2016 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
Verified Customer 06/23/2017 |
||
Application: | ICC | |
Species: | Feline |
Jason Spaeth 11/09/2016 |
||
Application: | IHC-Fr | |
Species: | Mouse |