NIPA Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: IQVHVTACILSVCGWACSSSLESMQLSLITCSQCMRKVGLWGFQQIESSMTDLDASFGLTSSPIPGLEGRPERLPLVPESPRRMMTRSQD |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ZC3HC1 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04 - 0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for NIPA Antibody
Background
Entry into mitosis is essentially driven by cyclin B1, which is located in the cytoplasm throughout interphase, but accumulates in the nucleus just before mitosis occurs. Nuclear interaction partner of ALK (NIPA) plays a critical role in cyclin B1 regulation. NIPA is normally phosphorylated during G2 and M phases, resulting in an accumulation of cyclin B1. When NIPA sheds its attached phosphate, it binds to SCF to form the SCFNIPA complex, a member of the E3 ubiquitin ligases, which ubiquitinates cyclin B1, thereby targeting it to the proteosome for degradation. Therefore, the accumulation of cyclin B1 is due to the inability of phosphorylated NIPA to bind to the molecule SCF, thereby preventing the degradation of cyclin B1. An absence of NIPA causes cyclin B1 to accumulate abnormally, leading to premature mitotic entry, loss of checkpoint control and genomic instability, which are all associated with cancer. The phosphorylated form of NIPA may also be involved in apoptotic signaling pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu(-)
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Mu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Publications for NIPA Antibody (NBP1-82564) (0)
There are no publications for NIPA Antibody (NBP1-82564).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NIPA Antibody (NBP1-82564) (0)
There are no reviews for NIPA Antibody (NBP1-82564).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NIPA Antibody (NBP1-82564) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NIPA Products
Research Areas for NIPA Antibody (NBP1-82564)
Find related products by research area.
|
Blogs on NIPA