![Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human cerebral cortex, colon, gallbladder and lymph node using Anti-SLC9A3 antibody NBP1-82575 (A) shows similar protein distribution across tissues to independent antibody NBP1-82574 (B).](http://images.novusbio.com/fullsize/NHE3-SLC9A3-Antibody-Immunohistochemistry-Paraffin-NBP1-82575-img0011.jpg "Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human cerebral cortex, colon, gallbladder and lymph node using Anti-SLC9A3 antibody NBP1-82575 (A) shows similar protein distribution across tissues to independent antibody NBP1-82574 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TDNVVNVDFTPRSSTVEASVSYLLRENVSAVCLDMQSLEQRRRSIRDAEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTM |
| Predicted Species | Mouse (93%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC9A3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. NHE3/SLC9A3 antibody validated for ICC/IF from a verified customer review. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
| Publication using NBP1-82575 | Applications | Species |
|---|---|---|
| Kasendra M, Tovaglieri A, Sontheimer-Phelps A, et al. Kasendra M, Tovaglieri A, Sontheimer-Phelps A, et al. Sci Rep. 2018-02-13 [PMID: 29440725] (ICC/IF, Human) | ICC/IF | Human |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Sasan Jalili |
ICC | Human and Human small intestine | 03/25/2020 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for NHE3/SLC9A3 Antibody (NBP1-82575)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Sasan Jalili 03/25/2020 |
||
| Application: | ICC | |
| Species: | Human and Human small intestine |
| Gene Symbol | SLC9A3 |
![Immunocytochemistry/Immunofluorescence: NHE3/SLC9A3 Antibody [NBP1-82575] - Immunofluorescence micrograph of human intestine showing polarized distribution of apical (NHE3) protein. ICC/IF image submitted by a verified customer review.](http://images.novusbio.com/fullsize/NHE3-SLC9A3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82575-img0015.jpg "Immunocytochemistry/Immunofluorescence: NHE3/SLC9A3 Antibody [NBP1-82575] - Immunofluorescence micrograph of human intestine showing polarized distribution of apical (NHE3) protein. ICC/IF image submitted by a verified customer review.")
![Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human liver shows no membranous positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/NHE3-SLC9A3-Antibody-Immunohistochemistry-Paraffin-NBP1-82575-img0021.jpg "Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human liver shows no membranous positivity in hepatocytes as expected.")
![Immunocytochemistry/Immunofluorescence: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human cell line U-2 OS shows localization to plasma membrane. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/NHE3-SLC9A3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82575-img0010.jpg "Immunocytochemistry/Immunofluorescence: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human cell line U-2 OS shows localization to plasma membrane. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human colon shows high expression.](http://images.novusbio.com/fullsize/NHE3-SLC9A3-Antibody-Immunohistochemistry-Paraffin-NBP1-82575-img0007.jpg "Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human colon shows high expression.")
![Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/NHE3-SLC9A3-Antibody-Immunohistochemistry-Paraffin-NBP1-82575-img0008.jpg "Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human lymph node.](http://images.novusbio.com/fullsize/NHE3-SLC9A3-Antibody-Immunohistochemistry-Paraffin-NBP1-82575-img0012.jpg "Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human gallbladder.](http://images.novusbio.com/fullsize/NHE3-SLC9A3-Antibody-Immunohistochemistry-Paraffin-NBP1-82575-img0013.jpg "Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human gallbladder.")
![Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/NHE3-SLC9A3-Antibody-Immunohistochemistry-Paraffin-NBP1-82575-img0014.jpg "Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Analysis in human colon and liver tissues using NBP1-82575 antibody. Corresponding SLC9A3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/NHE3-SLC9A3-Antibody-Immunohistochemistry-Paraffin-NBP1-82575-img0016.jpg "Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Analysis in human colon and liver tissues using NBP1-82575 antibody. Corresponding SLC9A3 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human colon shows strong positivity in apical membrane in glandular cells.](http://images.novusbio.com/fullsize/NHE3-SLC9A3-Antibody-Immunohistochemistry-Paraffin-NBP1-82575-img0017.jpg "Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human colon shows strong positivity in apical membrane in glandular cells.")
![Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human colon, kidney, liver and small intestine using Anti-SLC9A3 antibody NBP1-82575 (A) shows similar protein distribution across tissues to independent antibody NBP1-82574 (B).](http://images.novusbio.com/fullsize/NHE3-SLC9A3-Antibody-Immunohistochemistry-Paraffin-NBP1-82575-img0018.jpg "Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human colon, kidney, liver and small intestine using Anti-SLC9A3 antibody NBP1-82575 (A) shows similar protein distribution across tissues to independent antibody NBP1-82574 (B).")
![Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human gallbladder shows strong positivity in apical membrane in glandular cells.](http://images.novusbio.com/fullsize/NHE3-SLC9A3-Antibody-Immunohistochemistry-Paraffin-NBP1-82575-img0019.jpg "Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human gallbladder shows strong positivity in apical membrane in glandular cells.")
![Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human kidney shows moderate positivity in apical membrane in cells in tubules.](http://images.novusbio.com/fullsize/NHE3-SLC9A3-Antibody-Immunohistochemistry-Paraffin-NBP1-82575-img0020.jpg "Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human kidney shows moderate positivity in apical membrane in cells in tubules.")
![Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human small intestine shows moderate positivity in apical membrane in glandular cells.](http://images.novusbio.com/fullsize/NHE3-SLC9A3-Antibody-Immunohistochemistry-Paraffin-NBP1-82575-img0022.jpg "Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human small intestine shows moderate positivity in apical membrane in glandular cells.")
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![Simple Western DPPIV/CD26 Antibody [Unconjugated]](https://images.novusbio.com/images2/DPPIV_AF1180_Simple_Western_20720.jpg)
![Immunohistochemistry DPPIV/CD26 Antibody [Unconjugated]](https://images.novusbio.com/images2/DPPIV_AF1180_Immunohistochemistry_17209.jpg)
![Immunocytochemistry DPPIV/CD26 Antibody [Unconjugated]](https://images.novusbio.com/images2/DPPIV_AF1180_Immunocytochemistry__Immunofluorescence_17210.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
