![Immunohistochemistry-Paraffin: SLC4A4 Antibody [NBP2-32020] - Analysis in human kidney and lymph node tissues. Corresponding SLC4A4 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SLC4A4-Antibody-Immunohistochemistry-Paraffin-NBP2-32020-img0009.jpg "Immunohistochemistry-Paraffin: SLC4A4 Antibody [NBP2-32020] - Analysis in human kidney and lymph node tissues. Corresponding SLC4A4 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTS |
| Predicted Species | Mouse (95%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC4A4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-32020 | Applications | Species |
|---|---|---|
| Soto JS, Jami-Alahmadi Y, Chacon J et al. Astrocyte-neuron subproteomes and obsessive-compulsive disorder mechanisms Nature 2023-04-01 [PMID: 37046092] (IHC-Fr, Mouse) | IHC-Fr | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for SLC4A4 Antibody (NBP2-32020)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: SLC4A4 Antibody [NBP2-32020] - Staining of human pancreas shows strong membranous positivity in intercalated ducts.](http://images.novusbio.com/fullsize/SLC4A4-Antibody-Immunohistochemistry-Paraffin-NBP2-32020-img0012.jpg "Immunohistochemistry-Paraffin: SLC4A4 Antibody [NBP2-32020] - Staining of human pancreas shows strong membranous positivity in intercalated ducts.")
![Immunohistochemistry-Paraffin: SLC4A4 Antibody [NBP2-32020] - Staining of human kidney shows strong cytoplasmic/ membranous positivity in cells in tubules.](http://images.novusbio.com/fullsize/SLC4A4-Antibody-Immunohistochemistry-Paraffin-NBP2-32020-img0010.jpg "Immunohistochemistry-Paraffin: SLC4A4 Antibody [NBP2-32020] - Staining of human kidney shows strong cytoplasmic/ membranous positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: SLC4A4 Antibody [NBP2-32020] - Staining of human lymph node shows no positivity as expected.](http://images.novusbio.com/fullsize/SLC4A4-Antibody-Immunohistochemistry-Paraffin-NBP2-32020-img0011.jpg "Immunohistochemistry-Paraffin: SLC4A4 Antibody [NBP2-32020] - Staining of human lymph node shows no positivity as expected.")
![Immunohistochemistry-Paraffin: SLC4A4 Antibody [NBP2-32020] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.](http://images.novusbio.com/fullsize/SLC4A4-Antibody-Immunohistochemistry-Paraffin-NBP2-32020-img0013.jpg "Immunohistochemistry-Paraffin: SLC4A4 Antibody [NBP2-32020] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.")
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![Western Blot Carbonic Anhydrase IV/CA4 Antibody (310413) [Unconjugated]](https://images.novusbio.com/images2/Carbonic_Anhydrase_IV_MAB2186_Western_Blot_11051.jpg)
![Complement Component C2 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Complement Component C2 Antibody [Unconjugated]")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")