Home » MUC1 » MUC1 Proteins » Recombinant Human MUC1 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human MUC1 GST (N-Term) Protein

 (5 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Recombinant Human MUC-1 Protein [H00004582-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Recombinant Human MUC-1 Protein [H00004582-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human MUC1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 315-420 of Human MUC-1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDMETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWG
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
MUC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using H00004582-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MUC1 GST (N-Term) Protein

  • Breast carcinoma-associated antigen DF3
  • Carcinoma-associated mucin
  • CD227 antigen
  • CD227
  • DF3 antigen
  • EMA
  • Episialin
  • H23 antigen
  • H23AG
  • KL-6
  • MAM6
  • MUC-1
  • MUC1/ZD
  • mucin 1, cell surface associated
  • mucin 1, transmembrane
  • Mucin-1
  • Peanut-reactive urinary mucin
  • PEM
  • PEMMUC-1/SEC
  • PEMT
  • Polymorphic epithelial mucin
  • PUMMUC-1/X
  • tumor associated epithelial mucin
  • Tumor-associated epithelial membrane antigen
  • Tumor-associated mucin

Background

Mucin 1 (MUC1), also known as episialin, EMA (epithelial membrane antigen), PEM (polymorphic epithelial mucin), and CA-15-3 antigen, is a membrane-bound type I transmembrane glycoprotein (1,2). MUC1 is typically expressed in the luminal or glandular epithelial cells of the gastrointestinal tract, breast, lungs, and more, and is often overexpressed in epithelial cancers, but also serves a protective role against infection and helps regulate inflammatory response (2,3). Human MUC1 is 1255 amino acids (aa) in length with a theoretical molecular weight of 122 kDa; however, depending on the amount of glycosylation can weigh between 250 - 500 kDa (2,4). Structurally, MUC1 consists of a N-terminal domain which contains a signal peptide, a variable number tandem repeat region (VNTR), and a SEA domain, as well a C-terminal domain which has the extracellular domain (ECD), transmembrane domain (TMD), and cytoplasmic tail (CT) (2,3). The VNTR is comprised of between 25 - 125 repeats of a 20 aa conserved sequence (3). MUC1 is heavily O-glycosylated in the VNTR and has moderate N-glycosylation sites following the VNTR and in the ECD (2). Glycosylation contributes to MUC1's functional properties (2). The MUC1 gene contains seven exons, giving rise to several MUC1 isoforms as a result of alternative splicing (2).

Overexpression of mucins, including MUC1, is a feature of many epithelial cancers (1,3,5,6). The presence of truncated glycan structures called tumor-associated carbohydrate antigens (TACAs) on MUC1 play a role in cancer progression and a loss of apical-basal polarity (5). Carbohydrate-binding partners called lectins are the primary binding partners of TACAs that give rise to the pro-tumor microenvironment and metastasis (5). Given this unique feature, TACAs are a potential target for cancer immunotherapies (5). There are a number of vaccines, drugs, and antibodies targeting MUC1 for treatment of a variety of cancers including breast, lung, and prostate (6). In addition to a role in cancer progression, MUC1, and specifically the CT portion, has been shown to have a positive, anti-inflammatory role in a variety of lung and airway infections (7).

References

1. Khodabakhsh, F., Merikhian, P., Eisavand, M. R., & Farahmand, L. (2021). Crosstalk between MUC1 and VEGF in angiogenesis and metastasis: a review highlighting roles of the MUC1 with an emphasis on metastatic and angiogenic signaling. Cancer cell international. https://doi.org/10.1186/s12935-021-01899-8

2. Nath, S., & Mukherjee, P. (2014). MUC1: a multifaceted oncoprotein with a key role in cancer progression. Trends in molecular medicine. https://doi.org/10.1016/j.molmed.2014.02.007

3. Dhar, P., & McAuley, J. (2019). The Role of the Cell Surface Mucin MUC1 as a Barrier to Infection and Regulator of Inflammation. Frontiers in cellular and infection microbiology. https://doi.org/10.3389/fcimb.2019.00117

4. Uniprot (P15941)

5. Beckwith, D. M., & Cudic, M. (2020). Tumor-associated O-glycans of MUC1: Carriers of the glyco-code and targets for cancer vaccine design. Seminars in immunology. https://doi.org/10.1016/j.smim.2020.101389

6. Almasmoum H. (2021). The Roles of Transmembrane Mucins Located on Chromosome 7q22.1 in Colorectal Cancer. Cancer management and research. https://doi.org/10.2147/CMAR.S299089

7. Ballester, B., Milara, J., & Cortijo, J. (2021). The role of mucin 1 in respiratory diseases. European respiratory review : an official journal of the European Respiratory Society. https://doi.org/10.1183/16000617.0149-2020

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Vimentin Antibody
NB300-223
Immunocytochemistry/ Immunofluorescence Vimentin Antibody
Immunohistochemistry-Frozen Vimentin Antibody
Immunocytochemistry/ Immunofluorescence Vimentin Antibody
(6 Reviews)
(70 Publications)
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MUC2 Antibody
(996/1) - BSA Free
NB120-11197
Flow Cytometry MUC2 Antibody (996/1) - BSA Free
Flow (Intracellular) MUC2 Antibody (996/1) - BSA Free
Flow Cytometry MUC2 Antibody (996/1) - BSA Free
(1 Review)
(11 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
CEACAM5/CD66e
Antibody (CEA31) - Az ...
NBP2-34594
Immunohistochemistry-Paraffin CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free
Immunohistochemistry-Paraffin CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free
Immunohistochemistry-Paraffin CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free
(2 Reviews)
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
CEACAM7 Antibody
[Unconjugated]
AF4478
Immunohistochemistry CEACAM7 Antibody [Unconjugated]
Western Blot CEACAM7 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC, WB
PSG2 Antibody
NBP3-41306
Western Blot PSG2 Antibody
Western Blot PSG2 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
MUC5AC Antibody
(45M1)
NBP2-15196
Immunohistochemistry-Paraffin MUC5AC Antibody (45M1)
Immunohistochemistry-Paraffin MUC5AC Antibody (45M1)
Immunohistochemistry-Paraffin MUC5AC Antibody (45M1)
(5 Reviews)
(28 Publications)
Species: Bv(-), Ch, Fe, Hu, Ma, Pm, Mu, Po, Rb, Rt
Applications: DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Cytokeratin 7
Antibody (OV-TL12/30) ...
NBP2-47940
Simple Western Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free
Flow Cytometry Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free
Simple Western Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
MUC4 Antibody
(5B12)
H00004585-M07
ELISA MUC4 Antibody (5B12)
Immunohistochemistry-Paraffin MUC4 Antibody (5B12)
Western Blot MUC4 Antibody (5B12)
(5 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
ErbB2/Her2
[Unconjugated]
1129-ER
SDS-PAGE ErbB2/Her2 [Unconjugated]
Bioactivity ErbB2/Her2 [Unconjugated]
(58 Publications)
Species: Hu
Applications: BA
Desmin Antibody
[Unconjugated]
AF3844
Immunohistochemistry Desmin Antibody [Unconjugated]
Immunohistochemistry Desmin Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence Desmin Antibody [Unconjugated]
(2 Reviews)
(34 Publications)
Species: Hu, Mu
Applications: IHC
Cytokeratin 20
Antibody (SA35-03)
NBP2-67309
Flow Cytometry Cytokeratin 20 Antibody (SA35-03)
Immunocytochemistry/ Immunofluorescence Cytokeratin 20 Antibody (SA35-03)
Immunohistochemistry-Paraffin Cytokeratin 20 Antibody (SA35-03)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
GFAP Antibody
NB300-141
Immunohistochemistry GFAP Antibody
Western Blot GFAP Antibody
Western Blot GFAP Antibody
(12 Reviews)
(108 Publications)
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
MUC6 Antibody
(CLH5)
NBP2-44374
Immunohistochemistry-Paraffin MUC6 Antibody (CLH5)
Immunohistochemistry-Paraffin MUC6 Antibody (CLH5)
(4 Publications)
Species: Hu
Applications: Flow, ICC/IF, IF, IHC, IHC-P, IP, WB
CD34 Antibody
[Unconjugated]
AF4117
Immunohistochemistry CD34 Antibody [Unconjugated]
(3 Reviews)
(37 Publications)
Species: Rt
Applications: IHC, WB
SP-D [HRP]
DSFPD0
N/A SP-D [HRP]
N/A SP-D [HRP]
N/A SP-D [HRP]
(9 Publications)
Species: Hu
Applications: ELISA
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Enolase
2/Neuron-specific Eno ...
NB110-58870
Immunocytochemistry/ Immunofluorescence Enolase 2/Neuron-specific Enolase Antibody
Western Blot Enolase 2/Neuron-specific Enolase Antibody
Simple Western Enolase 2/Neuron-specific Enolase Antibody
(2 Reviews)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KD, Simple Western, WB

Publications for MUC1 Partial Recombinant Protein (H00004582-Q01)(5)


Reviews for MUC1 Partial Recombinant Protein (H00004582-Q01) (0)

There are no reviews for MUC1 Partial Recombinant Protein (H00004582-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MUC1 Partial Recombinant Protein (H00004582-Q01). (Showing 1 - 3 of 3 FAQs).

  1. I would like to perform a sandwich assay for the determination of MUC1 protein. May you suggest me some antibodies that can be used together? In particular, if possible, I should need antibodies product in mouse or rabbit.
    • Unfortunately we are not aware of a pair of antibodies that have been used in sandwich ELISA in particular. If you are interested in trying two you may find our Innovators Reward Program to be helpful.
  2. I am interested in purchasing MUC1 protein from you and it would be a great help if you could answer a few of my questions. 1) How much of the glycoprotein is glycosylated? 2) Is it soluble in water? 3) It says on the website that the product is not active, what exactly do you mean by that?
    • This protein is a recombinant protein. It does not undergo glycosylation. It may not be folded in the same way as the native protein therefore it may be not act in the same way. This should only be used for WB and as a positive control in ELISA. It is soluble in water.
  3. Could you recommend us a protocol for ELISA test in a sandwich format for MUC1 protein catalog # H00004582-Q01 using catalog # NB100-65647 as primary antibody and catalog # NBP1-61561 as secondary with a third labeled antibody? Regarding the request below with that pair of antibodies and that recombinant protein: could you help us with another primary monoclonal antibody to replace the NB100-65647 antibody with it, so we could use it in a sandwich assay with the protein H00004582-Q01 and the NBP1-61561. Thank you. Also do you know if this recombinant protein is tumoral MUC1 or normal MUC1, because they have different structures.
    • Unfortunately, the antibody and protein combination you have chosen will not work. As is stated in our datasheet for NB100-65647 The dominant epitope recognized by this antibody is the 12-mer GVTSAPDTRPAP. Unfortunately, this epitope is not present in the partial recombinant protein H00004582-Q01. While NB100-65647 and NBP1-61561 are suitable pairs to use for ELISA, H00004582-Q01 is not a suitable standard for use with this pair, and unfortunately it does not look like we carry a suitable standard for you. I apologize for the inconvenience. Please see our ELISA protocol. H00004582-Q01 is produced by a Taiwanese company called Abnova and we distribute it for them. It is produced in their cell-free wheat germ expression system. I would recommend using one of Abnova's matched antibody pairs for use in ELISA if you are going to use H00004582-Q01 as a standard. I would recommend using the H00004582-AP41 antibody pair.

Additional MUC1 Products

Research Areas for MUC1 Partial Recombinant Protein (H00004582-Q01)

Find related products by research area.

Blogs on MUC1.

Check out the latest blog posts on MUC1.
Harnessing Natural Killer Cell Activity for Anti-Tumor Immunotherapy
By Victoria Osinski, PhDWhat’s “Natural” About Natural Killer (NK) Cells?For immunologists, the term cytotoxicity often conjures up images of an army of antigen specific CD8+ T cells deploying to ...  Read full blog post.
Taking Biomarker Discovery From 2D to 3D: Increased Biological Activity of EVs Isolated From 3D Prostate Cancer Cultures
Jamshed Arslan, Pharm D, PhD Tissues within the human body are made of a three-dimensional (3D) arrangement of cells working together to perform vital functions. The commonly used 2D monolayer cultures have limited ...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunohistochemistry: GFAP Antibody [NB300-141] - Analysis of a rat cerebellum section stained with rabbit polyclonal antibody to GFAP, NB300-141, dilution 1:5000 in green and mouse monoclonal antibody to MeCP2, dilution 1:500, in red. The blue is DAPI staining of nuclear DNA. Following transcardial perfusion of rat with 4% paraformaldehyde, brain was post fixed for 1 hour, cut to 45 uM, and free-floating sections were stained with above antibodies. The GFAP antibody stains the network of astrocytic cells and the processes of Bergmann glia in the molecular layer. The MeCP2 antibody specifically labels nuclei of certain neurons.
GFAP Antibody
NB300-141
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Analysis of HeLa cell culture. Antibody at 1:10,000 in green, and costained with mouse mAb to actin, dilution 1:500 in red. The blue is DAPI staining of nuclear DNA. The vimentin antibody stains the intermediate filament network while the actin antibody labels the submembranous cytoskeleton, stress fibers, and bundles of actin associated with cell adhesion sites.
Vimentin Antibody
NB300-223

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MUC1 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol MUC1