![Western Blot: STK4 Antibody (4F4) [H00006789-M02] - STK4 monoclonal antibody (M02), clone 4F4. Analysis of STK4 expression in Raw 264.7.](http://images.novusbio.com/fullsize/STK4-Antibody-4F4-Western-Blot-H00006789-M02-img0013.jpg "Western Blot: STK4 Antibody (4F4) [H00006789-M02] - STK4 monoclonal antibody (M02), clone 4F4. Analysis of STK4 expression in Raw 264.7.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, Func, ICC/IF |
| Clone | 4F4 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | MST1/STK4 (NP_006273, 391 a.a. ~ 485 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQ |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | STK4 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for STK4 Antibody (H00006789-M02)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: STK4 Antibody (4F4) [H00006789-M02] - Analysis of monoclonal antibody to STK4 on HeLa cell. Antibody concentration 25 ug/ml.](http://images.novusbio.com/fullsize/STK4-Antibody-4F4-Immunocytochemistry-Immunofluorescence-H00006789-M02-img0009.jpg "Immunocytochemistry/Immunofluorescence: STK4 Antibody (4F4) [H00006789-M02] - Analysis of monoclonal antibody to STK4 on HeLa cell. Antibody concentration 25 ug/ml.")
![Western Blot: STK4 Antibody (4F4) [H00006789-M02] - STK4 monoclonal antibody (M02), clone 4F4 Analysis of STK4 expression in HeLa.](http://images.novusbio.com/fullsize/STK4-Antibody-4F4-Western-Blot-H00006789-M02-img0011.jpg "Western Blot: STK4 Antibody (4F4) [H00006789-M02] - STK4 monoclonal antibody (M02), clone 4F4 Analysis of STK4 expression in HeLa.")
![Western Blot: STK4 Antibody (4F4) [H00006789-M02] - STK4 monoclonal antibody (M02), clone 4F4. Analysis of STK4 expression in PC-12.](http://images.novusbio.com/fullsize/STK4-Antibody-4F4-Western-Blot-H00006789-M02-img0012.jpg "Western Blot: STK4 Antibody (4F4) [H00006789-M02] - STK4 monoclonal antibody (M02), clone 4F4. Analysis of STK4 expression in PC-12.")
![Western Blot: STK4 Antibody (4F4) [H00006789-M02] - STK4 monoclonal antibody (M02), clone 4F4. Analysis of STK4 expression in NIH/3T3.](http://images.novusbio.com/fullsize/STK4-Antibody-4F4-Western-Blot-H00006789-M02-img0014.jpg "Western Blot: STK4 Antibody (4F4) [H00006789-M02] - STK4 monoclonal antibody (M02), clone 4F4. Analysis of STK4 expression in NIH/3T3.")
![Proximity Ligation Assay: STK4 Antibody (4F4) [H00006789-M02] - Analysis of protein-protein interactions between TP53 and STK4. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-STK4 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).](http://images.novusbio.com/fullsize/STK4-Antibody-4F4-Proximity-Ligation-Assay-H00006789-M02-img0007.jpg "Proximity Ligation Assay: STK4 Antibody (4F4) [H00006789-M02] - Analysis of protein-protein interactions between TP53 and STK4. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-STK4 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).")
![ELISA: STK4 Antibody (4F4) [H00006789-M02] - Detection limit for recombinant GST tagged STK4 is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/STK4-Antibody-4F4-ELISA-H00006789-M02-img0015.jpg "ELISA: STK4 Antibody (4F4) [H00006789-M02] - Detection limit for recombinant GST tagged STK4 is approximately 0.1ng/ml as a capture antibody.")
![Bioactivity HGF [Unconjugated]](https://images.novusbio.com/images2/HGF_294HG_3253.jpg)
![Cell Culture HGF [Unconjugated]](https://images.novusbio.com/images/294-hg_recombinant-human-hgf-protein-cell-culture-252023111456.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_5991.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_6327.jpg)
![Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Immunocytochemistry__Immunofluorescence_20184.jpg)
