Independent Antibodies: Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human liver, skin, small intestine and testis using Anti-STK24 antibody NBP1-87833 (A) shows similar protein ...read more
Independent Antibodies: Western Blot: MST3 Antibody [NBP1-87833] - Analysis using Anti-STK24 antibody NBP1-87833 (A) shows similar pattern to independent antibody NBP1-87834 (B).
Immunocytochemistry/ Immunofluorescence: MST3 Antibody [NBP1-87833] - Staining of human cell line A-431 shows localization to nucleoli & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.
Western Blot: MST3 Antibody [NBP1-87833] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human liver shows very weak positivity in hepatocytes as expected.
ELISA: MST3 Antibody [NBP1-87833] - MST-3 levels in SH-SY5Y cell lysates. ELISA image added from a verified customer review
This antibody was developed against Recombinant Protein corresponding to amino acids: IDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STK24
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
The growth of axons is fundamental to the development and repair of brain circuitry. It has been shown that Mst3, a neuron-specific homolog of the yeast kinase Ste20, is critical for axon outgrowth. Mst3 is activated in response to trophic factors, and suppressing its expression or its function blocks axon outgrowth (1). Mst3 has been recently demonstrated to undergo a caspase-mediated cleavage during apoptosis. The proteolytic cleavage of the C-terminus of Mst3 caused nuclear translocation of its kinase domain. Mst3 contains both nuclear localization sequence (NLS) and NES signals, which may cooperate to control the subcellular distribution of Mst3 (2). In situ hybridization of rat brain sections indicated that MST3b is widely expressed in different brain regions, with especially high expression in hippocampus and cerebral cortex. When expressed in human embryonic kidney 293 (HEK293) cells, MST3b effectively phosphorylated myelin basic protein, as well as undergoing autophosphorylation (3)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
***Bio-Techne Response: This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.***
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.