MP1/MAP2K1IP1 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human MP1/MAP2K1IP1. Peptide sequence: LPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSK The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
LAMTOR3 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for MP1/MAP2K1IP1 Antibody
Background
The function of MAP2K1IP1/MAPKSP1 (MP1;MEK partner-1) a 14kDa scaffold protein, is to bind specifically to MEK1 and ERK1 and bring them in close proximity in order to facilitate their activation. Localized to the late endosome, MAP2K1IP1 also interacts with an adaptor protein p14. While the interaction between MAPKSP1-ERK1 can take place in the absence of the adaptor protein p14, it is strengthened in the presence of p14. Additionally, it has been suggested that the binding of MAP2K1IP1/MAPKSP1 to MEK1 resides in a proline-rich sequence (residue 270-307) of MEK1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: IHC, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Publications for MP1/MAP2K1IP1 Antibody (NBP2-87818) (0)
There are no publications for MP1/MAP2K1IP1 Antibody (NBP2-87818).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MP1/MAP2K1IP1 Antibody (NBP2-87818) (0)
There are no reviews for MP1/MAP2K1IP1 Antibody (NBP2-87818).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MP1/MAP2K1IP1 Antibody (NBP2-87818) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MP1/MAP2K1IP1 Products
Research Areas for MP1/MAP2K1IP1 Antibody (NBP2-87818)
Find related products by research area.
|
Blogs on MP1/MAP2K1IP1