![Western Blot: SF3B14 Antibody [NBP1-87431] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)](http://images.novusbio.com/fullsize/SF3B14-Antibody-Western-Blot-NBP1-87431-img0007.jpg "Western Blot: SF3B14 Antibody [NBP1-87431] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SF3B6 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-87431 | Applications | Species |
|---|---|---|
| Simmler P, Cortijo C, Koch LM et al. SF3B1 facilitates HIF1-signaling and promotes malignancy in pancreatic cancer Cell reports 2022-08-23 [PMID: 36001976] (WB) | WB |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SF3B6 |
![Immunocytochemistry/Immunofluorescence: SF3B14 Antibody [NBP1-87431] - Staining of human cell line U-2 OS shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/SF3B14-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87431-img0012.jpg "Immunocytochemistry/Immunofluorescence: SF3B14 Antibody [NBP1-87431] - Staining of human cell line U-2 OS shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87431] - Staining in human breast and skeletal muscle tissues using NBP1-87431 antibody. Corresponding SF3B6 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SF3B14-Antibody-Immunohistochemistry-Paraffin-NBP1-87431-img0020.jpg "Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87431] - Staining in human breast and skeletal muscle tissues using NBP1-87431 antibody. Corresponding SF3B6 RNA-seq data are presented for the same tissues.")
![Western Blot: SF3B14 Antibody [NBP1-87431] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/SF3B14-Antibody-Western-Blot-NBP1-87431-img0006.jpg "Western Blot: SF3B14 Antibody [NBP1-87431] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
![Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87431] - Staining of human breast, colon, skeletal muscle and testis using Anti-SF3B6 antibody NBP1-87431 (A) shows similar protein distribution across tissues to independent antibody NBP1-87430 (B).](http://images.novusbio.com/fullsize/SF3B14-Antibody-Immunohistochemistry-Paraffin-NBP1-87431-img0016.jpg "Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87431] - Staining of human breast, colon, skeletal muscle and testis using Anti-SF3B6 antibody NBP1-87431 (A) shows similar protein distribution across tissues to independent antibody NBP1-87430 (B).")
![Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87431] - Staining of human colon shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/SF3B14-Antibody-Immunohistochemistry-Paraffin-NBP1-87431-img0017.jpg "Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87431] - Staining of human colon shows moderate nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87431] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/SF3B14-Antibody-Immunohistochemistry-Paraffin-NBP1-87431-img0018.jpg "Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87431] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87431] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/SF3B14-Antibody-Immunohistochemistry-Paraffin-NBP1-87431-img0019.jpg "Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87431] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.")
![Western Blot S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Western_Blot_17324.jpg)
![Immunohistochemistry S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Immunohistochemistry_17440.jpg)
![Simple Western S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Simple_Western_18705.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")