Home » LSD1 » LSD1 Proteins » LSD1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

LSD1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for LSD1 Recombinant Protein Antigen (NBP2-58483PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

LSD1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LSD1.

Source: E. coli

Amino Acid Sequence: VEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KDM1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58483.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LSD1 Recombinant Protein Antigen

  • amine oxidase (flavin containing) domain 2
  • AOF2
  • AOF2lysine-specific histone demethylase 1
  • BHC110
  • BHC110FAD-binding protein BRAF35-HDAC complex, 110 kDa subunit
  • Flavin-containing amine oxidase domain-containing protein 2
  • KIAA0601KDM1
  • LSD1
  • LSD1BRAF35-HDAC complex protein BHC110
  • lysine (K)-specific demethylase 1
  • Lysine (K)specific Demethylase 1A
  • Lysine (K)-specific Demethylase 1A
  • lysine-specific histone demethylase 1A

Background

LSD1 a recently identified, first known lysine-specific histone demethylase, is an 886 amino acid nuclear protein belonging to flavin monoamine oxidase family. It contains a SWIRM domain, a FAD-binding motif and an amine oxidase domain. This protein is ubiquitously expressed and is a component of several histone deacetylase complexes. LSD1 acts as a component of the CoREST and other transcriptional co-repressor complexes and also plays an important role in silencing neuronal-specific genes in non-neuronal cells. It is also known to demethylate Lys-4 of histone H3, a specific tag for epigenetic transcriptional activation. Reports suggest that it plays an important role in stimulating androgen-receptor-dependent transcription converting oxygen to hydrogen peroxide (might use alternative electron acceptors). Along with nuclear FHL2 it serves as a novel biomarker predictive for prostate cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Histone H3
Antibody - BSA Free
NB500-171
Immunohistochemistry-Paraffin Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
(8 Reviews)
(34 Publications)
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
MBD2 Antibody
NB100-55415
Western Blot MBD2 Antibody
Immunohistochemistry-Paraffin MBD2 Antibody
Immunohistochemistry-Paraffin MBD2 Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
RCOR1/CoREST
Antibody (9B3R7)
NBP3-16225
Immunohistochemistry-Paraffin RCOR1/CoREST Antibody (9B3R7)
Immunohistochemistry-Paraffin RCOR1/CoREST Antibody (9B3R7)
Immunohistochemistry-Paraffin RCOR1/CoREST Antibody (9B3R7)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ChIP, IHC, IHC-P, IP, WB
HDAC1 Antibody
NB100-56340
Western Blot HDAC1 Antibody
Simple Western HDAC1 Antibody
Western Blot HDAC1 Antibody
(2 Reviews)
(19 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
SETD7/9 Antibody
NB100-56664
Immunohistochemistry-Paraffin SETD7/9 Antibody
Western Blot SETD7/9 Antibody
Western Blot SETD7/9 Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, WB
DNMT1 Antibody
(60B1220.1) - BSA Fre
NB100-56519
Flow Cytometry DNMT1 Antibody (60B1220.1) - BSA Free
Flow Cytometry DNMT1 Antibody (60B1220.1) - BSA Free
Immunoprecipitation DNMT1 Antibody (60B1220.1) - BSA Free
(4 Reviews)
(144 Publications)
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HDAC9 Antibody -
BSA Free
NBP2-03993
Western Blot HDAC9 Antibody - BSA Free
(1 Review)
(1 Publication)
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
Lysine
(K)-specific Demethyl ...
NB110-40585
Immunoprecipitation Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody
Western Blot Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody
Western Blot Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody
(2 Reviews)
(12 Publications)
Species: Hu, Mu
Applications: ICC/IF, IP, WB
AOF1 Antibody
(5E10C1) - BSA Free
NBP2-52415
Flow Cytometry AOF1 Antibody (5E10C1) - BSA Free
ELISA AOF1 Antibody (5E10C1) - BSA Free
Immunocytochemistry/ Immunofluorescence AOF1 Antibody (5E10C1) - BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Presenilin-1
Antibody (APS 18)
NB100-74510
Western Blot Presenilin-1 Antibody (APS 18)
Immunocytochemistry/ Immunofluorescence Presenilin-1 Antibody (APS 18)
Immunocytochemistry/ Immunofluorescence Presenilin-1 Antibody (APS 18)
(1 Review)
(5 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
FANCD2 Antibody -
BSA Free
NB100-182
Immunocytochemistry/ Immunofluorescence FANCD2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence FANCD2 Antibody - BSA Free
Western Blot FANCD2 Antibody - BSA Free
(8 Reviews)
(229 Publications)
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, RNAi, Simple Western, WB
BRCA2 Antibody
(234403) [Unconjugate
MAB2476
Western Blot BRCA2 Antibody (234403) [Unconjugated]
Immunohistochemistry BRCA2 Antibody (234403) [Unconjugated]
Western Blot BRCA2 Antibody (234403) [Unconjugated]
(13 Publications)
Species: Hu
Applications: IHC, WB
Oct-3/4 Antibody
[Unconjugated]
AF1759
Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]
Immunocytochemistry Oct-3/4 Antibody [Unconjugated]
Simple Western Oct-3/4 Antibody [Unconjugated]
(77 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Lysine
(K)-specific Demethyl ...
NBP1-49600
Immunocytochemistry/ Immunofluorescence Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Antibody - BSA Free
Western Blot Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Antibody - BSA Free
(1 Review)
(11 Publications)
Species: Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Histone
Deacetylase 2/HDAC2 A
NBP1-87109
Immunocytochemistry/ Immunofluorescence Histone Deacetylase 2/HDAC2 Antibody
Western Blot Histone Deacetylase 2/HDAC2 Antibody
Immunohistochemistry-Paraffin Histone Deacetylase 2/HDAC2 Antibody
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TLX/NR2E1 Antibody
(H6506)
PP-H6506-00
Immunohistochemistry TLX/NR2E1 Antibody (H6506)
Species: Hu
Applications: DirELISA, IP, WB
PHF21A Antibody
NBP2-88046
Western Blot PHF21A Antibody
Western Blot PHF21A Antibody
Western Blot PHF21A Antibody
Species: Hu
Applications: WB

Publications for LSD1 Recombinant Protein Antigen (NBP2-58483PEP) (0)

There are no publications for LSD1 Recombinant Protein Antigen (NBP2-58483PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LSD1 Recombinant Protein Antigen (NBP2-58483PEP) (0)

There are no reviews for LSD1 Recombinant Protein Antigen (NBP2-58483PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LSD1 Recombinant Protein Antigen (NBP2-58483PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LSD1 Products

Research Areas for LSD1 Recombinant Protein Antigen (NBP2-58483PEP)

Find related products by research area.

Blogs on LSD1

There are no specific blogs for LSD1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: FANCD2 Antibody - BSA Free [NB100-182] - FANCD2 Antibody [NB100-182] - Analysis using the Biotin conjugate of FANCD2 Antibody. FANCD2 colocalizes in vivo with another protein in SiHa cells after cell exposure to IR. Proliferating SiHa cells were exposed to 10 Gy of IR and double color immunofluorescence staining was performed after 8 h. Images were captured in a Kodak digital image system on a Leica fluorescence microscope.
FANCD2 Antibody - BSA Free
NB100-182
Flow Cytometry: DNMT1 Antibody (60B1220.1) [NB100-56519] - Analysis of PE conjugate of NB100-56519. An intracellular stain was performed on HeLa cells with DNMT1 antibody (60B1220.1) NB100-56519PE (blue) and a matched isotype control NBP2-27287PE (orange). Cells were fixed with 4% PFA and then permeablized with 0
DNMT1 Antibody (60B1220.1) - BSA Free
NB100-56519

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LSD1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol KDM1A