Home » LPCAT3 » LPCAT3 Antibodies » LPCAT3 Antibody - Azide and BSA Free
Novus Biologicals products are now on bio-techne.com

LPCAT3 Antibody - Azide and BSA Free

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: LPCAT3 Antibody [NBP3-04752] - nalysis of lysates from HepG2 cells, using LPCAT3 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit Exposure time: 30s.
Western Blot: LPCAT3 Antibody [NBP3-04752] - nalysis of lysates from HepG2 cells, using LPCAT3 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug ...read more
IHC-P-NBP3-04752-LPCAT3 Antibody - Azide and BSA Free- Analysis of LPCAT3 in paraffin-embedded rat kidney tissue using LPCAT3 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed ...read more
IHC-P-NBP3-04752-LPCAT3 Antibody - Azide and BSA Free- Mouse kidney tissue using LPCAT3 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) ...read more
IHC-P-NBP3-04752-LPCAT3 Antibody - Azide and BSA Free- Human liver tissue using LPCAT3 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price
Azide and BSA Free
NBP3-04752-20ul
Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

LPCAT3 Antibody - Azide and BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human LPCAT3 (NP_005759.4). GPQFSMNHYMKLVQGELIDIPGKIPNSIIPALKRLSLGLFYLVGYTLLSPHITEDYLLTEDYDNHPFWFRCMYMLIWGKFVLYKYVTCWLVTEGVCILTGL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LPCAT3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 -1:200
  • Western Blot 1:500 - 1:1000
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP3-04752 in the following applications:

  • IB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.05% Proclin 300
Purity
Affinity purified

Alternate Names for LPCAT3 Antibody - Azide and BSA Free

  • 1-acylglycerophosphocholine O-acyltransferase
  • 1-acylglycerophosphoserine O-acyltransferase
  • C3F
  • EC 2.3.1.-
  • EC 2.3.1.23
  • EC 2.3.1.n6
  • LPCAT
  • LPLAT 5
  • Lyso-PC acyltransferase 3
  • Lyso-PC acyltransferase
  • lysophosphatidylcholine acyltransferase 3LPSAT
  • Lysophosphatidylcholine acyltransferase
  • Lysophosphatidylserine acyltransferase
  • lysophospholipid acyltransferase 5
  • Lyso-PS acyltransferase
  • MBOAT5OACT5
  • membrane bound O-acyltransferase domain containing 5
  • Membrane-bound O-acyltransferase domain-containing protein 5
  • nessy
  • O-acyltransferase (membrane bound) domain containing 5
  • O-acyltransferase domain-containing protein 5
  • putative protein similar to nessy

Background

Acyltransferase which mediates the conversion of lysophosphatidylcholine (1-acyl-sn-glycero-3-phosphocholine or LPC) into phosphatidylcholine (1,2-diacyl-sn-glycero-3-phosphocholine or PC) (LPCAT activity). Catalyzes also the conversion of lysophosphatidylserine (1-acyl-2-hydroxy-sn-glycero-3-phospho-L-serine or LPS) into phosphatidylserine (1,2-diacyl-sn-glycero-3-phospho-L-serine or PS) (LPSAT activity). Has also weak lysophosphatidylethanolamine acyltransferase activity (LPEAT activity). Favors polyunsaturated fatty acyl-CoAs as acyl donors compared to saturated fatty acyl-CoAs. Seems to be the major enzyme contributing to LPCAT activity in the liver. Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Complement C3
Antibody (11H9) - BSA ...
NB200-540
Flow Cytometry Complement C3 Antibody (11H9) - BSA Free
Immunocytochemistry/ Immunofluorescence Complement C3 Antibody (11H9) - BSA Free
Immunohistochemistry-Paraffin Complement C3 Antibody (11H9) - BSA Free
(2 Reviews)
(31 Publications)
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Phospholipase B1
Antibody
H00151056-B01P
Western Blot Phospholipase B1 Antibody
(1 Publication)
Species: Hu, Mu
Applications: WB
LPCAT1 Antibody
NBP1-88923
Western Blot LPCAT1 Antibody
Immunohistochemistry-Paraffin LPCAT1 Antibody
Immunohistochemistry-Paraffin LPCAT1 Antibody
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AGPAT1 Antibody
NBP2-57898
Western Blot AGPAT1 Antibody
Immunohistochemistry-Paraffin AGPAT1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
PLA2G1B Antibody
(630823)
MAB5018
Western Blot PLA2G1B Antibody (630823)
Species: Hu
Applications: IP, WB
MBOAT2 Antibody
NBP1-82236
Western Blot MBOAT2 Antibody
Immunohistochemistry-Paraffin MBOAT2 Antibody
Immunohistochemistry-Paraffin MBOAT2 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, KD, WB
14-3-3 zeta
Antibody (818515) [Un ...
MAB2669
Simple Western 14-3-3 zeta Antibody (818515) [Unconjugated]
Western Blot 14-3-3 zeta Antibody (818515) [Unconjugated]
Immunohistochemistry 14-3-3 zeta Antibody (818515) [Unconjugated]
(2 Reviews)
(1 Publication)
Species: Hu
Applications: IHC, Simple Western, WB
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
PLA2G4A Antibody
NBP1-31344
Immunocytochemistry/ Immunofluorescence PLA2G4A Antibody
Immunohistochemistry-Paraffin PLA2G4A Antibody
Western Blot PLA2G4A Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
ORC3L Antibody
NB100-796
Western Blot ORC3L Antibody
Immunohistochemistry-Paraffin ORC3L Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
SPNS1 Antibody -
BSA Free
NBP2-41252
Immunohistochemistry SPNS1 Antibody - BSA Free
Immunohistochemistry-Paraffin SPNS1 Antibody - BSA Free
Western Blot SPNS1 Antibody - BSA Free
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
LAT Antibody
NBP2-27104
Western Blot LAT Antibody
Immunohistochemistry-Paraffin LAT Antibody
Species: Hu, Mu, Pm
Applications: IHC, IHC-P, WB
LPCAT2 Antibody
NBP1-88921
Immunocytochemistry/ Immunofluorescence LPCAT2 Antibody
Immunohistochemistry-Paraffin LPCAT2 Antibody
Immunohistochemistry-Paraffin LPCAT2 Antibody
(2 Reviews)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Proprotein
Convertase 7/PCSK7 An ...
NBP2-73621
Flow Cytometry Proprotein Convertase 7/PCSK7 Antibody (OTI1B8) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence Proprotein Convertase 7/PCSK7 Antibody (OTI1B8) - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF
LCAT Antibody
NBP1-05950
Western Blot LCAT Antibody
Immunocytochemistry/ Immunofluorescence LCAT Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Prolyl
Oligopeptidase/PREP A
NBP2-33950
Immunocytochemistry/ Immunofluorescence Prolyl Oligopeptidase/PREP Antibody
Immunohistochemistry-Paraffin Prolyl Oligopeptidase/PREP Antibody
Immunohistochemistry-Paraffin Prolyl Oligopeptidase/PREP Antibody
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AP3B1 Antibody
NBP1-89228
Immunocytochemistry/ Immunofluorescence AP3B1 Antibody
Immunohistochemistry-Paraffin AP3B1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MBOAT7 Antibody
NBP2-49207
Immunohistochemistry-Paraffin MBOAT7 Antibody
Immunohistochemistry-Paraffin MBOAT7 Antibody
Immunohistochemistry-Paraffin MBOAT7 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
LPCAT3 Antibody -
Azide and BSA Free
NBP3-04752
LPCAT3 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for LPCAT3 Antibody (NBP3-04752)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IB.


Filter By Application
IB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for LPCAT3 Antibody (NBP3-04752) (0)

There are no reviews for LPCAT3 Antibody (NBP3-04752). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LPCAT3 Antibody (NBP3-04752) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LPCAT3 Products

Blogs on LPCAT3

There are no specific blogs for LPCAT3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LPCAT3 Antibody - Azide and BSA Free and receive a gift card or discount.


Bioinformatics

Gene Symbol LPCAT3