![Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Analysis in human lung and liver tissues. Corresponding LPCAT1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/LPCAT1-Antibody-Immunohistochemistry-Paraffin-NBP1-88923-img0010.jpg "Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Analysis in human lung and liver tissues. Corresponding LPCAT1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LPCAT1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF reported in scientific literature (PMID: 24557352). For IHC-Paraffin, HIER pH 6 retrieval is recommended. LPCAT1 antibody validated for IHC from a verified customer review. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Martin Helley |
IHC | Rat | 02/12/2013 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LPCAT1 |
![Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human cerebral cortex, kidney, liver and lung using Anti-LPCAT1 antibody NBP1-88923 (A) shows similar protein distribution across tissues to independent antibody NBP1-88922 (B).](http://images.novusbio.com/fullsize/LPCAT1-Antibody-Immunohistochemistry-Paraffin-NBP1-88923-img0009.jpg "Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human cerebral cortex, kidney, liver and lung using Anti-LPCAT1 antibody NBP1-88923 (A) shows similar protein distribution across tissues to independent antibody NBP1-88922 (B).")
![Western Blot: LPCAT1 Antibody [NBP1-88923] - Analysis in human cell lines PC-3 and Caco-2 using anti-LPCAT1 antibody. Corresponding LPCAT1 RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.](http://images.novusbio.com/fullsize/LPCAT1-Antibody-Western-Blot-NBP1-88923-img0008.jpg "Western Blot: LPCAT1 Antibody [NBP1-88923] - Analysis in human cell lines PC-3 and Caco-2 using anti-LPCAT1 antibody. Corresponding LPCAT1 RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.")
![Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human lung shows moderate to strong cytoplasmic positivity in pneumocytes.](http://images.novusbio.com/fullsize/LPCAT1-Antibody-Immunohistochemistry-Paraffin-NBP1-88923-img0013.jpg "Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human lung shows moderate to strong cytoplasmic positivity in pneumocytes.")
![Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/LPCAT1-Antibody-Immunohistochemistry-Paraffin-NBP1-88923-img0011.jpg "Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/LPCAT1-Antibody-Immunohistochemistry-Paraffin-NBP1-88923-img0012.jpg "Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/LPCAT1-Antibody-Immunohistochemistry-Paraffin-NBP1-88923-img0014.jpg "Immunohistochemistry-Paraffin: LPCAT1 Antibody [NBP1-88923] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.")
![Simple Western 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/1433_zeta_MAB2669_Simple_Western_16526.jpg)
![Western Blot 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/14-3-3_zeta_MAB2669_Western_Blot_12700.jpg)
![Immunohistochemistry 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/14-3-3_zeta_MAB2669_Immunohistochemistry_12730.jpg)
![N/A PLA2G7/PAF-AH/Lp-PLA2 [HRP]](https://images.novusbio.com/images2/PLA2G7_DPLG70_ELISA_161.jpg)
![N/A PLA2G7/PAF-AH/Lp-PLA2 [HRP]](https://images.novusbio.com/images2/DATA_PLA2G7_DPLG70_ELISA_794.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
