![Western Blot: LPCAT2 Antibody [NBP1-88921] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/LPCAT2-Antibody-Western-Blot-NBP1-88921-img0010.jpg "Western Blot: LPCAT2 Antibody [NBP1-88921] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FALFDRNHDGSIDFREYVIGLAVLCNPSNTEEIIQVAFKLFDVDEDGYITEEEFSTILQASLGVPDLDVSGLFKEIAQGDSISYEEFKSFALKHPEYAKIFTTYLDLQTCHVFSLPKEVQTTPSTASNKVSPE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LPCAT2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
IHC-Fr | Rat | 02/20/2015 |
Summary
|
||||||
|
reviewed by:
Martin Helley |
ICC | Mouse | 02/12/2013 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for LPCAT2 Antibody (NBP1-88921)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 02/20/2015 |
||
| Application: | IHC-Fr | |
| Species: | Rat |
| Martin Helley 02/12/2013 |
||
| Application: | ICC | |
| Species: | Mouse |
| Gene Symbol | LPCAT2 |
![Immunocytochemistry/Immunofluorescence: LPCAT2 Antibody [NBP1-88921] - Staining of human cell line A-431 shows localization to endoplasmic reticulum & lipid droplets.](http://images.novusbio.com/fullsize/LPCAT2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88921-img0011.jpg "Immunocytochemistry/Immunofluorescence: LPCAT2 Antibody [NBP1-88921] - Staining of human cell line A-431 shows localization to endoplasmic reticulum & lipid droplets.")
![Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921] - Analysis in human thyroid gland and skeletal muscle tissues using NBP1-88921 antibody. Corresponding LPCAT2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/LPCAT2-Antibody-Immunohistochemistry-Paraffin-NBP1-88921-img0022.jpg "Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921] - Analysis in human thyroid gland and skeletal muscle tissues using NBP1-88921 antibody. Corresponding LPCAT2 RNA-seq data are presented for the same tissues.")
![Western Blot: LPCAT2 Antibody [NBP1-88921] - Analysis in human thyroid gland tissue.](http://images.novusbio.com/fullsize/LPCAT2-Antibody-Western-Blot-NBP1-88921-img0009.jpg "Western Blot: LPCAT2 Antibody [NBP1-88921] - Analysis in human thyroid gland tissue.")
![Immunocytochemistry/Immunofluorescence: LPCAT2 Antibody [NBP1-88921] - Staining of murine cell line RAW264.7. Image provided by product review by verified customer.](http://images.novusbio.com/fullsize/LPCAT2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88921-img0005.jpg "Immunocytochemistry/Immunofluorescence: LPCAT2 Antibody [NBP1-88921] - Staining of murine cell line RAW264.7. Image provided by product review by verified customer.")
![Immunohistochemistry-Frozen: LPCAT2 Antibody [NBP1-88921] - Staining of LPCAT2 in rat neuronal tissue using anti-LPCAT2 antibody. Image from verified customer review.](http://images.novusbio.com/fullsize/LPCAT2-Antibody-Immunohistochemistry-Frozen-NBP1-88921-img0007.jpg "Immunohistochemistry-Frozen: LPCAT2 Antibody [NBP1-88921] - Staining of LPCAT2 in rat neuronal tissue using anti-LPCAT2 antibody. Image from verified customer review.")
![Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921] - Staining of human skeletal muscle shows very weak positivity in myocytes.](http://images.novusbio.com/fullsize/LPCAT2-Antibody-Immunohistochemistry-Paraffin-NBP1-88921-img0018.jpg "Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921] - Staining of human skeletal muscle shows very weak positivity in myocytes.")
![Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921] - Staining of human small intestine shows weak membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/LPCAT2-Antibody-Immunohistochemistry-Paraffin-NBP1-88921-img0019.jpg "Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921] - Staining of human small intestine shows weak membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921] - Staining of human testis shows weak granular cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize/LPCAT2-Antibody-Immunohistochemistry-Paraffin-NBP1-88921-img0020.jpg "Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921] - Staining of human testis shows weak granular cytoplasmic positivity in Leydig cells.")
![Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921] - Staining of human thyroid gland shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/LPCAT2-Antibody-Immunohistochemistry-Paraffin-NBP1-88921-img0021.jpg "Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921] - Staining of human thyroid gland shows strong granular cytoplasmic positivity in glandular cells.")
![Simple Western 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/1433_zeta_MAB2669_Simple_Western_16526.jpg)
![Western Blot 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/14-3-3_zeta_MAB2669_Western_Blot_12700.jpg)
![Immunohistochemistry 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/14-3-3_zeta_MAB2669_Immunohistochemistry_12730.jpg)
![N/A PLA2G7/PAF-AH/Lp-PLA2 [HRP]](https://images.novusbio.com/images2/PLA2G7_DPLG70_ELISA_161.jpg)
![N/A PLA2G7/PAF-AH/Lp-PLA2 [HRP]](https://images.novusbio.com/images2/DATA_PLA2G7_DPLG70_ELISA_794.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
