Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, IHC, IP |
Clone | 9K10Z3 |
Clonality | Monoclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Additional Information | Recombinant Monoclonal Antibody |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 318-417 of human LOX (P28300). GHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY |
Isotype | IgG |
Clonality | Monoclonal |
Host | Rabbit |
Gene | LOX |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
Preservative | 0.02% Sodium Azide |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for LOX Antibody (NBP3-15396)Find related products by research area.
|
LOX: A prime enzyme LOX is a copper-dependent amine oxidase enzyme that executes post-translational oxidative deamination on peptidyl lysine residues in precursors of fibrous collagen and elastin. LOX is secreted into the extracellular environment in an inactive form, wh... Read full blog post. |
Understanding DNA Recombination with Cre-Lox Cyclization recombination enzyme (Cre) is a member of the extensive family of recombinases and recognizes a 34 bp sequence motif from PI bacteriophage referred to as LoxP. The Cre enzyme works to cleanly excise an intervening DNA fragment that is flan... Read full blog post. |
Cre/Lox: The Genomic Utility Knife Cre (Cyclization recombination enzyme) is a member of the large family of recombinases. Cre recognizes Lox site loxP, a 34 bp sequence motif from the PI bateriophage. If a DNA segment is flanked by two loxP sites in the same orientation, Cre neatly ex... Read full blog post. |
LOX propeptide: A novel peptide cancer therapeutic Lysyl oxidase, also known as LOX, is a copper-dependent enzyme that cross-links collagen and elastin through the oxidative deamination of peptidyl lysine (collagen and elastin) and hydroxylysine (collagen only) residues, thereby playing a critical rol... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | LOX |