![Western Blot: LOX Antibody (9K10Z3) [NBP3-15396] - Western blot analysis of extracts of various cell lines, using LOX Rabbit mAb (NBP3-15396) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/LOX-Antibody-9K10Z3-Western-Blot-NBP3-15396-img0003.jpg "Western Blot: LOX Antibody (9K10Z3) [NBP3-15396] - Western blot analysis of extracts of various cell lines, using LOX Rabbit mAb (NBP3-15396) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, IP |
| Clone | 9K10Z3 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 318-417 of human LOX (P28300). GHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | LOX |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for LOX Antibody (NBP3-15396)Find related products by research area.
|
|
LOX: A prime enzyme LOX is a copper-dependent amine oxidase enzyme that executes post-translational oxidative deamination on peptidyl lysine residues in precursors of fibrous collagen and elastin. LOX is secreted into the extracellular environment in an inactive form, wh... Read full blog post. |
|
Understanding DNA Recombination with Cre-Lox Cyclization recombination enzyme (Cre) is a member of the extensive family of recombinases and recognizes a 34 bp sequence motif from PI bacteriophage referred to as LoxP. The Cre enzyme works to cleanly excise an intervening DNA fragment that is flan... Read full blog post. |
|
Cre/Lox: The Genomic Utility Knife Cre (Cyclization recombination enzyme) is a member of the large family of recombinases. Cre recognizes Lox site loxP, a 34 bp sequence motif from the PI bateriophage. If a DNA segment is flanked by two loxP sites in the same orientation, Cre neatly ex... Read full blog post. |
|
LOX propeptide: A novel peptide cancer therapeutic Lysyl oxidase, also known as LOX, is a copper-dependent enzyme that cross-links collagen and elastin through the oxidative deamination of peptidyl lysine (collagen and elastin) and hydroxylysine (collagen only) residues, thereby playing a critical rol... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LOX |
![Immunohistochemistry-Paraffin: LOX Antibody (9K10Z3) [NBP3-15396] - Immunohistochemistry of paraffin-embedded human colon using LOX Rabbit mAb (NBP3-15396) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/LOX-Antibody-9K10Z3-Immunohistochemistry-Paraffin-NBP3-15396-img0002.jpg "Immunohistochemistry-Paraffin: LOX Antibody (9K10Z3) [NBP3-15396] - Immunohistochemistry of paraffin-embedded human colon using LOX Rabbit mAb (NBP3-15396) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: LOX Antibody (9K10Z3) [NBP3-15396] - Immunohistochemistry of paraffin-embedded rat kidney using LOX Rabbit mAb (NBP3-15396) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/LOX-Antibody-9K10Z3-Immunohistochemistry-Paraffin-NBP3-15396-img0001.jpg "Immunohistochemistry-Paraffin: LOX Antibody (9K10Z3) [NBP3-15396] - Immunohistochemistry of paraffin-embedded rat kidney using LOX Rabbit mAb (NBP3-15396) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunoprecipitation: LOX Antibody (9K10Z3) [NBP3-15396] - Immunoprecipitation analysis of 300ug extracts of Jurkat cells using 3ug LOX antibody (NBP3-15396). Western blot was performed from the immunoprecipitate using LOX antibody (NBP3-15396) at a dilition of 1:1000.](http://images.novusbio.com/fullsize/LOX-Antibody-9K10Z3-Immunoprecipitation-NBP3-15396-img0004.jpg "Immunoprecipitation: LOX Antibody (9K10Z3) [NBP3-15396] - Immunoprecipitation analysis of 300ug extracts of Jurkat cells using 3ug LOX antibody (NBP3-15396). Western blot was performed from the immunoprecipitate using LOX antibody (NBP3-15396) at a dilition of 1:1000.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot BMP-1/PCP Antibody [Unconjugated]](https://images.novusbio.com/images2/BMP1_AF1927_Western_Blot_21018.jpg)
![Western Blot BMP-1/PCP Antibody [Unconjugated]](https://images.novusbio.com/images2/BMP1_AF1927_Western_Blot_21019.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Immunohistochemistry CTGF/CCN2 Antibody [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CTGF_AF660_Immunohistochemistry_9968.jpg)
![Immunohistochemistry CTGF/CCN2 Antibody [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CTGF_AF660_Immunohistochemistry_9969.jpg)
![Western Blot CTGF/CCN2 Antibody [Unconjugated] - C-terminus](https://images.novusbio.com/images/af660_human-ctgf-ccn2-c-terminus-affinity-purified-polyclonal-ab-822024951141.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")