Home » LMO2 » LMO2 Proteins » LMO2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

LMO2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for LMO2 Recombinant Protein Antigen (NBP2-58513PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

LMO2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LMO2.

Source: E. coli

Amino Acid Sequence: KSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LMO2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58513.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LMO2 Recombinant Protein Antigen

  • Cysteine-rich protein TTG-2
  • LIM domain only 2 (rhombotin-like 1)
  • LIM domain only protein 2
  • LMO2
  • LMO-2
  • RBTN2
  • RBTN2rhombotin-2
  • RBTNL1
  • RBTNL1rhombotin-like 1
  • RHOM2
  • RHOM2T-cell translocation protein 2
  • T-cell translocation gene 2
  • TTG2
  • TTG2rhombotin 2

Background

LMO2 is a highly conserved oncoprotein that is expressed in human normal germinal-center B cells and in B-cell lymphomas. LMO2 also has a crucial role in hematopoietic development by being necessary for yolk sac erythropoiesis. LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number of T-cell acute lymphoblastic leukemia-specific translocations occur.

LMO2 antibodies are useful tools for erythropoiesis research and certian cancer studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SCL/Tal1 Antibody
(OTI5H1)
NBP2-01488
Western Blot SCL/Tal1 Antibody (OTI5H1)
Flow Cytometry SCL/Tal1 Antibody (OTI5H1)
Immunocytochemistry/ Immunofluorescence SCL/Tal1 Antibody (OTI5H1)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
GATA-1 Antibody
(4F5) - BSA Free
NBP1-47492
Immunohistochemistry GATA-1 Antibody (4F5) - BSA Free
Immunocytochemistry/ Immunofluorescence GATA-1 Antibody (4F5) - BSA Free
Immunohistochemistry-Paraffin GATA-1 Antibody (4F5) - BSA Free
(1 Review)
(2 Publications)
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
SCLY Antibody
NBP2-48693
Immunohistochemistry-Paraffin SCLY Antibody
Immunocytochemistry/ Immunofluorescence SCLY Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Cytokeratin 7
Antibody (OV-TL12/30) ...
NBP2-47940
Simple Western Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free
Flow Cytometry Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free
Simple Western Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
LDB1 Antibody
NBP1-31362
Knockout Validated LDB1 Antibody
Immunohistochemistry-Paraffin LDB1 Antibody
Western Blot LDB1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
LMO1 Antibody (4F7)
H00004004-M01
Immunocytochemistry/ Immunofluorescence LMO1 Antibody (4F7)
Species: Hu
Applications: ELISA, ICC/IF, WB
LDB2 Antibody
(PCRP-LDB2-1B10)
NBP3-23662
Flow Cytometry LDB2 Antibody (PCRP-LDB2-1B10)
Immunohistochemistry-Paraffin LDB2 Antibody (PCRP-LDB2-1B10)
Protein Array LDB2 Antibody (PCRP-LDB2-1B10)
Species: Hu
Applications: Flow, ICC/IF, IHC-P
TCF-3/E2A Antibody
(826927) [Unconjugate ...
MAB7650
Western Blot TCF-3/E2A Antibody (826927) [Unconjugated]
Immunohistochemistry TCF-3/E2A Antibody (826927) [Unconjugated]
(2 Publications)
Species: Mu
Applications: IHC, WB
GATA-2 Antibody
[Unconjugated]
AF2046
Western Blot GATA-2 Antibody [Unconjugated]
Simple Western GATA-2 Antibody [Unconjugated]
Western Blot GATA-2 Antibody [Unconjugated]
(11 Publications)
Species: Hu, Mu
Applications: ICC, IHC, Simple Western, WB
TCF7L1/TCF3
Antibody
AF6116
Immunocytochemistry TCF7L1/TCF3 Antibody
Western Blot TCF7L1/TCF3 Antibody
(2 Publications)
Species: Hu
Applications: ICC, WB
PDLIM5 Antibody
NBP1-84843
Immunocytochemistry/ Immunofluorescence PDLIM5 Antibody
Immunohistochemistry-Paraffin PDLIM5 Antibody
Immunohistochemistry-Paraffin PDLIM5 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PU.1/Spi-1 Antibody
NBP2-27163
Western Blot PU.1/Spi-1 Antibody
Western Blot PU.1/Spi-1 Antibody
Flow Cytometry PU.1/Spi-1 Antibody
(1 Review)
(1 Publication)
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: Flow, WB
HOX11 Antibody
NB100-56424
Western Blot HOX11 Antibody
Species: Hu, Mu, Rt
Applications: WB
GATA-2 Antibody
[Unconjugated]
AF2046
Western Blot GATA-2 Antibody [Unconjugated]
Simple Western GATA-2 Antibody [Unconjugated]
Western Blot GATA-2 Antibody [Unconjugated]
(11 Publications)
Species: Hu, Mu
Applications: ICC, IHC, Simple Western, WB
LMO4 Antibody
AF3889
LMO4 Antibody
Species: Hu, Mu
Applications: WB
RUNX1/CBFA2
Antibody
NBP1-89105
Immunocytochemistry/ Immunofluorescence RUNX1/CBFA2 Antibody
Immunohistochemistry-Paraffin RUNX1/CBFA2 Antibody
Immunohistochemistry-Paraffin RUNX1/CBFA2 Antibody
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PDLIM4 Antibody
NBP1-80833
Immunocytochemistry/ Immunofluorescence PDLIM4 Antibody
Western Blot PDLIM4 Antibody
Immunohistochemistry-Paraffin PDLIM4 Antibody
(4 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PDLIM7 Antibody
NBP1-84841
Immunohistochemistry-Paraffin PDLIM7 Antibody
Immunocytochemistry/ Immunofluorescence PDLIM7 Antibody
Western Blot PDLIM7 Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CSRP3 Antibody
NBP1-06983
Western Blot CSRP3 Antibody
Immunohistochemistry-Paraffin CSRP3 Antibody
Immunohistochemistry-Paraffin CSRP3 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PEP-ELISA, WB
LMO2 Recombinant
Protein Antigen
NBP2-58513PEP
LMO2 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for LMO2 Recombinant Protein Antigen (NBP2-58513PEP) (0)

There are no publications for LMO2 Recombinant Protein Antigen (NBP2-58513PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMO2 Recombinant Protein Antigen (NBP2-58513PEP) (0)

There are no reviews for LMO2 Recombinant Protein Antigen (NBP2-58513PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LMO2 Recombinant Protein Antigen (NBP2-58513PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LMO2 Products

Research Areas for LMO2 Recombinant Protein Antigen (NBP2-58513PEP)

Find related products by research area.

Blogs on LMO2

There are no specific blogs for LMO2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LMO2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol LMO2