![Immunocytochemistry/Immunofluorescence: LMO1 Antibody (4F7) [H00004004-M01] - Analysis of monoclonal antibody to LMO1 on HeLa cell . Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/LMO1-Antibody-4F7-Immunocytochemistry-Immunofluorescence-H00004004-M01-img0002.jpg "Immunocytochemistry/Immunofluorescence: LMO1 Antibody (4F7) [H00004004-M01] - Analysis of monoclonal antibody to LMO1 on HeLa cell . Antibody concentration 10 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 4F7 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | LMO1 (NP_002306, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MMVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAA |
| Specificity | LMO1 (4F7) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | LMO1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for LMO1 Antibody (H00004004-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry LMO2 Antibody [Unconjugated]](https://images.novusbio.com/images2/LMO2_AF2726_Immunocytochemistry_10616.jpg)
![Flow Cytometry LMO2 Antibody [Unconjugated]](https://images.novusbio.com/images2/LMO2_AF2726_Flow_Cytometry_22133.jpg)
![Flow Cytometry LMO2 Antibody [Unconjugated]](https://images.novusbio.com/images2/LMO2_AF2726_Flow_Cytometry_22134.jpg)
![Western Blot TCF-3/E2A Antibody (826927) [Unconjugated]](https://images.novusbio.com/images2/TCF3_MAB7650_Western_Blot_12841.jpg)
![Immunohistochemistry TCF-3/E2A Antibody (826927) [Unconjugated]](https://images.novusbio.com/images2/TCF3_MAB7650_Immunohistochemistry_12859.jpg)
![Western Blot GATA-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/GATA-3_AF2605_Western_Blot_5199.jpg)
![Immunocytochemistry GATA-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/GATA-3_AF2605_Immunocytochemistry_6486.jpg)
![Simple Western GATA-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/GATA3_AF2605_Simple_Western_16988.jpg)
