Novus Biologicals products are now on bio-techne.com

LAMP-1/CD107a Recombinant Protein Antigen

Images

 
There are currently no images for LAMP-1/CD107a Recombinant Protein Antigen (NBP1-86557PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

LAMP-1/CD107a Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LAMP1.

Source: E. coli

Amino Acid Sequence: SPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVLLFQFGMNASSSRFFLQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LAMP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86557.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LAMP-1/CD107a Recombinant Protein Antigen

  • CD107 antigen-like family member A
  • CD107a antigen
  • CD107a
  • LAMP1
  • LAMP-1
  • LAMPA
  • LGP120
  • lysosomal-associated membrane protein 1
  • lysosome-associated membrane glycoprotein 1
  • Lysosome-associated membrane protein 1

Background

LAMP-1 (lysosome-associated membrane protein 1), also known as CD107a (cluster of differentiation 107a), is a major component of lysosomal membranes that plays an important role in lysosomal biogenesis, autophagy, and cholesterol metabolism (1). LAMP-1 is a type I transmembrane glycoprotein that is expressed on plasma membranes and the membranes of endosomes, autolysosomes, and lysosomes (1,2). Additionally, LAMP-1/CD107a is a commonly used marker for natural killer (NK) cell degranulation (3). LAMP-1 and another lysosomal-associated membrane protein, LAMP-2, together make up about half of all lysosome membrane proteins (1). Additionally, LAMP-1 has a role in presenting carbohydrate ligands to selectins (2). Human LAMP-1 protein is comprised of 417 amino acids (aa) with a theoretical molecular weight of 44.8 kDa; however, glycosylation can increase the molecular weight upwards of 120 kDa (1, 4). Structurally, LAMP-1 protein contains a large luminal/extracellular domain (29-382 aa), a helical transmembrane domain (383-405 aa), and a short cytoplasmic tail (406-417 aa) (1,2). Additionally, the protein has many N- and O-linked glycosylation sites which helps with stability in the membrane (1,2).

LAMP-1 plays an important role in autophagy-mediated ATP-release during apoptosis where lysosomes containing intracellular ATP migrate to the plasma membrane and, during exocytosis, LAMP-1 is exposed to the cell surface (5). Studies have found that knockdown of LAMP-1 blocks the ATP release from the cell (5). Furthermore, an absence of LAMP-1 and LAMP-2 leads to an accumulation of lysosomal cholesterol (6). Lysosomal membrane dysfunction or defects has also been associated with disease development (6,7). For example, one feature of pancreatitis is autophagy impairment which is caused by lysosomal dysfunction and a corresponding decrease in lysosomal-membrane associated proteins LAMP-1 and LAMP-2 (7).

References

1. Eskelinen E. L. (2006). Roles of LAMP-1 and LAMP-2 in lysosome biogenesis and autophagy. Molecular aspects of medicine, 27(5-6), 495-502. https://doi.org/10.1016/j.mam.2006.08.005

2. Cheng, X. T., Xie, Y. X., Zhou, B., Huang, N., Farfel-Becker, T., & Sheng, Z. H. (2018). Revisiting LAMP1 as a marker for degradative autophagy-lysosomal organelles in the nervous system. Autophagy, 14(8), 1472-1474. https://doi.org/10.1080/15548627.2018.1482147

3. Krzewski, K., & Coligan, J. E. (2012). Human NK cell lytic granules and regulation of their exocytosis. Frontiers in immunology, 3, 335. https://doi.org/10.3389/fimmu.2012.00335

4. Uniprot (P11279)

5. Wang, Y., Martins, I., Ma, Y., Kepp, O., Galluzzi, L., & Kroemer, G. (2013). Autophagy-dependent ATP release from dying cells via lysosomal exocytosis. Autophagy, 9(10), 1624-1625. https://doi.org/10.4161/auto.25873

6. Schwake, M., Schr0der, B., & Saftig, P. (2013). Lysosomal membrane proteins and their central role in physiology. Traffic (Copenhagen, Denmark), 14(7), 739-748. https://doi.org/10.1111/tra.12056

7. Gukovsky, I., Pandol, S. J., Mareninova, O. A., Shalbueva, N., Jia, W., & Gukovskaya, A. S. (2012). Impaired autophagy and organellar dysfunction in pancreatitis. Journal of gastroenterology and hepatology, 27 Suppl 2(Suppl 2), 27-32. https://doi.org/10.1111/j.1440-1746.2011.07004.x

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-22217
Species: Ch, Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
202-IL
Species: Hu
Applications: BA
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-42225
Species: Ca, Hu
Applications: B/N, DB, EM, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC-WhMt, IP, In vitro, WB
AF1029
Species: Mu
Applications: ICC, IHC, IP, WB
DDX0191P-100
Species: Ca, Fe, Hu, Mu, Sh
Applications: ICC/IF, IHC, IHC-P
NBP2-36568
Species: Hu, Mu
Applications: Flow-IC, ICC/IF, IHC, IHC-P, WB
AF873
Species: Hu
Applications: WB
H00338382-M01
Species: Hu
Applications: ELISA, IP, WB
NBP1-87174
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-2331
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IP, Simple Western, SB, WB
MAB139
Species: Hu
Applications: CostimT, CyTOF-ready, Flow, Neut, WB
NBP1-86557PEP
Species: Hu
Applications: AC

Publications for LAMP-1/CD107a Recombinant Protein Antigen (NBP1-86557PEP) (0)

There are no publications for LAMP-1/CD107a Recombinant Protein Antigen (NBP1-86557PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LAMP-1/CD107a Recombinant Protein Antigen (NBP1-86557PEP) (0)

There are no reviews for LAMP-1/CD107a Recombinant Protein Antigen (NBP1-86557PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LAMP-1/CD107a Recombinant Protein Antigen (NBP1-86557PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LAMP-1/CD107a Products

Research Areas for LAMP-1/CD107a Recombinant Protein Antigen (NBP1-86557PEP)

Find related products by research area.

Blogs on LAMP-1/CD107a

There are no specific blogs for LAMP-1/CD107a, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LAMP-1/CD107a Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMP1