![Western Blot: L1CAM Antibody [NBP3-03276] - Analysis of extracts of various cell lines, using L1CAM antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 30s.](http://images.novusbio.com/fullsize/L1CAM-Antibody-Western-Blot-NBP3-03276-img0002.jpg "Western Blot: L1CAM Antibody [NBP3-03276] - Analysis of extracts of various cell lines, using L1CAM antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 30s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1143-1257 of human L1CAM (NP_000416.1). IKRSKGGKYSVKDKEDTQVDSEARPMKDETFGEYRSLESDNEEKAFGSSQPSLNGDIKPLGSDDSLADYGGSVDVQFNEDGSFIGQYSGKKEKEAAGGNDSSGATSPINPAVALE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | L1CAM |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS with 50% glycerol, pH7.3. |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot NCAM-1/CD56 Antibody [Unconjugated]](https://images.novusbio.com/images2/NCAM1_AF2408_Western_Blot_20725.jpg)
![Simple Western NCAM-1/CD56 Antibody [Unconjugated]](https://images.novusbio.com/images2/NCAM1_AF2408_Simple_Western_20928.jpg)
![Immunocytochemistry NCAM-1/CD56 Antibody [Unconjugated]](https://images.novusbio.com/images2/NCAM1_AF2408_Immunocytochemistry_16574.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for L1CAM Antibody (NBP3-03276)Find related products by research area.
|
|
Identifying tumoral and stromal transcriptomes that underlie tumor plasticity and stromal neuroinflammatory response in brain metastasis By Jamshed Arslan, Pharm. D., PhD. Cancers in the brain often come from tumors elsewhere in the body. Several adaptive mechanisms influence brain metastasis, such as blood brain barrier leakage that can be induced by ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | L1CAM |
![Immunocytochemistry/Immunofluorescence: L1CAM Antibody [NBP3-03276] - Analysis of SH-SY5Y cells using [KO Validated] L1CAM Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/L1CAM-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03276-img0005.jpg "Immunocytochemistry/Immunofluorescence: L1CAM Antibody [NBP3-03276] - Analysis of SH-SY5Y cells using [KO Validated] L1CAM Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: L1CAM Antibody [NBP3-03276] - Analysis of HeLa cells using [KO Validated] L1CAM Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/L1CAM-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03276-img0003.jpg "Immunocytochemistry/Immunofluorescence: L1CAM Antibody [NBP3-03276] - Analysis of HeLa cells using [KO Validated] L1CAM Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: L1CAM Antibody [NBP3-03276] - Analysis of Neuro-2a cells using [KO Validated] L1CAM Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/L1CAM-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03276-img0004.jpg "Immunocytochemistry/Immunofluorescence: L1CAM Antibody [NBP3-03276] - Analysis of Neuro-2a cells using [KO Validated] L1CAM Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.")
![Western Blot CD47 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD47_AF4670_Western_Blot_15788.jpg)
![Neutralization CD47 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD47_AF4670_Block_Neutralize_11560.jpg)
![Immunohistochemistry CD47 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD47_AF4670_Immunohistochemistry_6841.jpg)
![Western Blot Protein S/PROS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protein_S_AF4036_Western_Blot_17082.jpg)
![Simple Western Protein S/PROS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protein_S_AF4036_Simple_Western_18689.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_729.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_730.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/Kallikrein_3_DKK300_ELISA_124.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")