![Western Blot: KDM6A Antibody - Azide and BSA Free [KDM6A] - Western blot analysis of various lysates, using KDM6A Rabbit pAb at 1:700 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 60s.](http://images.novusbio.com/fullsize/nbp3-05103_rabbit-polyclonal-kdm6a-antibody-5220251638023.jpg "Western Blot: KDM6A Antibody - Azide and BSA Free [KDM6A] - Western blot analysis of various lysates, using KDM6A Rabbit pAb at 1:700 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 60s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 550-700 of mouse KDM6A (NP_033509.1). MPSVSQPGVHTACPRQTLANGPFSAGHVPCSTSRTLGSTDTVLIGNNHVTGSGSNGNVPYLQRNAPTLPHNRTNLTSSTEEPWKNQLSNSTQGLHKGPSSHLAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KDM6A |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.09% Sodium Azide |
| Purity | Affinity purified |
![Western Blot Jak1 Antibody (413104) [Unconjugated]](https://images.novusbio.com/images2/Jak1_MAB4260_Western_Blot_6164.jpg)
![Immunohistochemistry Jak1 Antibody (413104) [Unconjugated]](https://images.novusbio.com/images2/Jak1_MAB4260_Immunohistochemistry_7021.jpg)
![Intracellular Staining by Flow Cytometry Jak1 Antibody (413104) [Unconjugated]](https://images.novusbio.com/images2/Jak1_MAB4260_Flow_Cytometry_8448.jpg)
Secondary Antibodies |
Isotype Controls |
|
Breast cancer stem cells survive chemotherapy through S100A10-ANXA2-SPT6 interaction that epigenetically promotes OCT4-mediated stemness By Jamshed Arslan, Pharm D, PhDBreast cancer is the most common cancer among women that causes the greatest number of cancer-related deaths worldwide. After radiotherapy or cytotoxic chemotherapy like paclitax... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KDM6A |
![Immunohistochemistry-Paraffin: KDM6A Antibody [NBP3-05103] - Paraffin-embedded human breast cancer using KDM6A antibody at dilution of 1:200 (40x lens).](http://images.novusbio.com/fullsize/KDM6A-Antibody-Immunohistochemistry-Paraffin-NBP3-05103-img0001.jpg "Immunohistochemistry-Paraffin: KDM6A Antibody [NBP3-05103] - Paraffin-embedded human breast cancer using KDM6A antibody at dilution of 1:200 (40x lens).")
![Western Blot EZH2/KMT6 Antibody [Unconjugated]](https://images.novusbio.com/images2/EZH2_AF4767_Western_Blot_12571.jpg)
![Western Blot EZH2/KMT6 Antibody [Unconjugated]](https://images.novusbio.com/images/af4767_human-mouse-ezh2-affinity-purified-polyclonal-ab-4120241240516.jpg)
![Western Blot EZH2/KMT6 Antibody [Unconjugated]](https://images.novusbio.com/images/af4767_human-mouse-ezh2-affinity-purified-polyclonal-ab-4120241240219.jpg)
![Western Blot Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Western_Blot_5829.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11663.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11664.jpg)
![Knockout Validated Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]](https://images.novusbio.com/images2/Isocitrate_Dehydrogenase_1_MAB7049_Knockout_Validated_22540.jpg)
![Immunocytochemistry Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]](https://images.novusbio.com/images2/Isocitrate_Dehydrogenase_1_MAB7049_Immunocytochemistry__Immunofluorescence_19067.jpg)
![Western Blot Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]](https://images.novusbio.com/images2/Isocitrate_Dehydrogenase_1_MAB7049_Western_Blot_13853.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")