Home » KDEL » KDEL Proteins » KDEL Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

KDEL Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for KDEL Recombinant Protein Antigen (NBP2-57105PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

KDEL Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KDEL.

Source: E. coli

Amino Acid Sequence: HENCDCPLQDSAAWLREMNCPETIAQIQRDLAHFPAVDPEKIAVEIPKRFGQRQSLCHYTLKDNKVYIKTHGEHVG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
POGLUT2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57105.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KDEL Recombinant Protein Antigen

  • Endoplasmic reticulum resident protein 58
  • EP58KDEL1
  • ER protein 58
  • ERp58
  • KDEL (Lys-Asp-Glu-Leu) containing 1
  • KDEL motif-containing 1
  • KDEL motif-containing protein 1
  • MGC5302

Background

The sequence Lys-Asp-Glu-Leu (KDEL) or a closely related sequence, is present at the carboxy-terminus of soluble endoplasmic reticulum (ER) resident proteins and some membrane proteins. 78 and 94 kDa glucose regulated proteins (GRP 78) and GRP 94 respectively and protein disulfide isomerase (PDI) all share the C-terminal KDEL sequence. The presence of carboxy-terminal KDEL appears to be necessary for ER retention and appears to be sufficient to reduce the secretion of proteins from the ER. This retention is reported to be mediated by a KDEL receptor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

BIVM Antibody
NBP1-31214
Immunocytochemistry/ Immunofluorescence BIVM Antibody
Immunohistochemistry BIVM Antibody
Immunohistochemistry-Paraffin BIVM Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Protogenin
Antibody [Unconjugate
AF4919
Immunohistochemistry Protogenin Antibody [Unconjugated]
Immunohistochemistry Protogenin Antibody [Unconjugated]
Immunohistochemistry Protogenin Antibody [Unconjugated]
Species: Mu
Applications: IHC, WB
p19 INK4d Antibody
(DCS-100)
NBP3-11884
Immunocytochemistry/ Immunofluorescence p19 INK4d Antibody (DCS-100)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, RIA, WB
VPS41 Antibody
NB100-2425
Immunohistochemistry-Paraffin VPS41 Antibody
Immunohistochemistry-Paraffin VPS41 Antibody
Immunohistochemistry-Paraffin VPS41 Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Cytochrome P450
2E1 Antibody
NBP1-85367
Western Blot Cytochrome P450 2E1 Antibody
Immunohistochemistry-Paraffin Cytochrome P450 2E1 Antibody
Immunohistochemistry-Paraffin Cytochrome P450 2E1 Antibody
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt, V-Vi
Applications: ICC/IF, IHC, IHC-P, WB
Protein
O-Glucosyltransferase ...
NBP1-90311
Western Blot Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody
Immunohistochemistry-Paraffin Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody
Immunohistochemistry-Paraffin Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Reg1A Antibody
(431202) [Unconjugate
MAB4937
Intracellular Staining by Flow Cytometry Reg1A Antibody (431202) [Unconjugated]
(2 Publications)
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
IL-23A/IL-23 P19
[Unconjugated]
1290-IL
SEC-MALS IL-23A/IL-23 P19 [Unconjugated]
(115 Publications)
Species: Hu
Applications: BA
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(842 Publications)
Species: Hu
Applications: BA
KDELC2 Antibody
NBP1-92047
Western Blot KDELC2 Antibody
Immunocytochemistry/ Immunofluorescence KDELC2 Antibody
Immunohistochemistry-Paraffin KDELC2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DNAJB11 Antibody
NBP1-84899
Immunohistochemistry-Paraffin DNAJB11 Antibody
Western Blot DNAJB11 Antibody
Western Blot DNAJB11 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Factor IX Antibody
NBP1-33581
Immunohistochemistry-Paraffin Factor IX Antibody
Immunohistochemistry-Paraffin Factor IX Antibody
Immunocytochemistry/ Immunofluorescence Factor IX Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P
Nestin Antibody
(196908) [Unconjugate
MAB1259
Immunocytochemistry Nestin Antibody (196908) [Unconjugated]
Intracellular Staining by Flow Cytometry Nestin Antibody (196908) [Unconjugated]
Western Blot Nestin Antibody (196908) [Unconjugated]
(3 Reviews)
(161 Publications)
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Notch-2 Antibody
[Unconjugated]
AF3735
Immunohistochemistry Notch-2 Antibody [Unconjugated]
(6 Publications)
Species: Hu
Applications: IHC, WB
KDEL Recombinant
Protein Antigen
NBP2-57105PEP
KDEL Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for KDEL Recombinant Protein Antigen (NBP2-57105PEP) (0)

There are no publications for KDEL Recombinant Protein Antigen (NBP2-57105PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KDEL Recombinant Protein Antigen (NBP2-57105PEP) (0)

There are no reviews for KDEL Recombinant Protein Antigen (NBP2-57105PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KDEL Recombinant Protein Antigen (NBP2-57105PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KDEL Products

Array NBP2-57105PEP

Research Areas for KDEL Recombinant Protein Antigen (NBP2-57105PEP)

Find related products by research area.

Blogs on KDEL

There are no specific blogs for KDEL, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunohistochemistry-Paraffin: KDEL Antibody (10C3) [NBP1-97469] - Analysis of human spleen tissue stained with KDEL, mAb (10C3) at 10 ug/mL.
KDEL Antibody (10C3)
NBP1-97469-0.1mg
Nestin was detected in immersion fixed human fetal neural progenitor cells using 10 µg/mL Human Nestin Monoclonal Antibody (Catalog # MAB1259) for 3 hours at room temperature. Cells were stained (green) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Nestin Antibody (196908) [Unconjugated]
MAB1259

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KDEL Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol POGLUT2