| Reactivity | HuSpecies Glossary |
| Applications | AC |
| Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRIM28. Source: E. coli Amino Acid Sequence: TDSTFSLDQPGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKADVQSIIGLQRFFETRMNEAFGDTKFSAVLV Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source | E. coli |
| Protein/Peptide Type | Recombinant Protein Antigen |
| Gene | TRIM28 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-39014. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here. |
| Theoretical MW | 27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for KAP1 Protein (NBP2-39014PEP)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TRIM28 |
![N/A alpha-Defensin 1 [Biotin]](https://images.novusbio.com/images2/DATA_alphaDefensin_1_DY819805_ELISA_2534.jpg)
![Western Blot Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/Histone_H2AX_AF2288_Western_Blot_5182.jpg)
![Simple Western Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/16395.jpg)
![Immunocytochemistry Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/Histone_H2AX_AF2288_Immunocytochemistry__Immunofluorescence_16920.jpg)
![Immunohistochemistry-Paraffin: KAP1 [p Ser824] Antibody [NB100-2350] - FFPE serial sections of asynchronous HeLa cells treated with EPE (left) anduntreated HeLa cells (right). Antibody: Affinity purified rabbit anti-Phospho KAP-1 (S824) used at a dilution of 1:200 (1ug/ml). Detection: DAB](https://images.novusbio.com/images/KAP1-[p-Ser824]-Antibody-Immunohistochemistry-Paraffin-NB100-2350-img0013.jpg "Immunohistochemistry-Paraffin: KAP1 [p Ser824] Antibody [NB100-2350] - FFPE serial sections of asynchronous HeLa cells treated with EPE (left) anduntreated HeLa cells (right). Antibody: Affinity purified rabbit anti-Phospho KAP-1 (S824) used at a dilution of 1:200 (1ug/ml). Detection: DAB")