![Immunocytochemistry/Immunofluorescence: IWS1 Antibody [NBP2-49349] - Staining of human cell line CACO-2 shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/IWS1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49349-img0003.jpg "Immunocytochemistry/Immunofluorescence: IWS1 Antibody [NBP2-49349] - Staining of human cell line CACO-2 shows localization to nucleoplasm.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NEELPKPRISDSESEDPPRNQASDSENEELPKPRVSDSESEGPQKGPASDSETEDASRHKQKPESDDDSDRENKGEDTEMQND |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IWS1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | IWS1 |
![Immunohistochemistry-Paraffin: IWS1 Antibody [NBP2-49349] - Staining of human placenta shows high expression.](http://images.novusbio.com/fullsize/IWS1-Antibody-Immunohistochemistry-Paraffin-NBP2-49349-img0005.jpg "Immunohistochemistry-Paraffin: IWS1 Antibody [NBP2-49349] - Staining of human placenta shows high expression.")
![Immunocytochemistry/Immunofluorescence: IWS1 Antibody [NBP2-49349] - Analysis of human cell line CACO-2 shows positivity in nucleus but excluded from the nucleoli.](http://images.novusbio.com/fullsize/IWS1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49349-img0001.jpg "Immunocytochemistry/Immunofluorescence: IWS1 Antibody [NBP2-49349] - Analysis of human cell line CACO-2 shows positivity in nucleus but excluded from the nucleoli.")
![Immunohistochemistry-Paraffin: IWS1 Antibody [NBP2-49349] - Staining of human rectum shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/IWS1-Antibody-Immunohistochemistry-Paraffin-NBP2-49349-img0002.jpg "Immunohistochemistry-Paraffin: IWS1 Antibody [NBP2-49349] - Staining of human rectum shows moderate nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: IWS1 Antibody [NBP2-49349] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/IWS1-Antibody-Immunohistochemistry-Paraffin-NBP2-49349-img0004.jpg "Immunohistochemistry-Paraffin: IWS1 Antibody [NBP2-49349] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: IWS1 Antibody [NBP2-49349] - Staining in human placenta and pancreas tissues using anti-IWS1 antibody. Corresponding IWS1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/IWS1-Antibody-Immunohistochemistry-Paraffin-NBP2-49349-img0006.jpg "Immunohistochemistry-Paraffin: IWS1 Antibody [NBP2-49349] - Staining in human placenta and pancreas tissues using anti-IWS1 antibody. Corresponding IWS1 RNA-seq data are presented for the same tissues.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")