![Immunohistochemistry-Paraffin: SUPT5H Antibody [NBP1-83508] - Staining in human testis and pancreas tissues using anti-SUPT5H antibody. Corresponding SUPT5H RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SUPT5H-Antibody-Immunohistochemistry-Paraffin-NBP1-83508-img0013.jpg "Immunohistochemistry-Paraffin: SUPT5H Antibody [NBP1-83508] - Staining in human testis and pancreas tissues using anti-SUPT5H antibody. Corresponding SUPT5H RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VGYSPMTPGAPSPGGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SUPT5H |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-83508 | Applications | Species |
|---|---|---|
| Arabi A, Ullah K, Branca RM et al. Proteomic screen reveals Fbw7 as a modulator of the NF-kappa pathway. Nat Commun 2012-01-01 [PMID: 22864569] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: SUPT5H Antibody [NBP1-83508] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/SUPT5H-Antibody-Western-Blot-NBP1-83508-img0008.jpg "Western Blot: SUPT5H Antibody [NBP1-83508] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunocytochemistry/Immunofluorescence: SUPT5H Antibody [NBP1-83508] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/SUPT5H-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83508-img0010.jpg "Immunocytochemistry/Immunofluorescence: SUPT5H Antibody [NBP1-83508] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.")
![Western Blot: SUPT5H Antibody [NBP1-83508] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-560](http://images.novusbio.com/fullsize/SUPT5H-Antibody-Western-Blot-NBP1-83508-img0006.jpg "Western Blot: SUPT5H Antibody [NBP1-83508] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-560")
![Immunohistochemistry-Paraffin: SUPT5H Antibody [NBP1-83508] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/SUPT5H-Antibody-Immunohistochemistry-Paraffin-NBP1-83508-img0011.jpg "Immunohistochemistry-Paraffin: SUPT5H Antibody [NBP1-83508] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: SUPT5H Antibody [NBP1-83508] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/SUPT5H-Antibody-Immunohistochemistry-Paraffin-NBP1-83508-img0012.jpg "Immunohistochemistry-Paraffin: SUPT5H Antibody [NBP1-83508] - Staining of human testis shows high expression.")
![Knockout Validated Calcitonin R Antibody (462802) [Unconjugated]](https://images.novusbio.com/images2/Calcitonin_R_MAB4614_Knockout_Validated_23018.jpg)
![Flow Cytometry Calcitonin R Antibody (462802) [Unconjugated]](https://images.novusbio.com/images2/Calcitonin_R_MAB4614_Flow_Cytometry_8474.jpg)
![Immunocytochemistry/ Immunofluorescence Calcitonin R Antibody (462802) [Unconjugated]](https://images.novusbio.com/images/mab4614_human-calcitonin-r-mab-clone-462802-41202410484315.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")