Reactivity | RtSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Concentration | 0.5 mg/ml |
Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
Immunogen | The immunogen for this antibody is Tat. Peptide sequence PGLQPVRPSGAMYLMVGIEMEHFPEFENDVEFTERLIAEQAVHCLPATCF. The peptide sequence for this immunogen was taken from within the described region. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | TAT |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Reviewed Applications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS, 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Concentration | 0.5 mg/ml |
Purity | Affinity purified |
Images | Ratings | Applications | Species | Date | Details | ||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
reviewed by:
Verified Customer |
WB | Human | 06/20/2017 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for TAT Antibody (NBP1-79286)Find related products by research area.
|
Methamphetamine with HIV induces mitochondrial dysfunction and neuronal injury through oxidative stress By Jamshed Arslan, Pharm. D., PhD. December 1 is the World AIDS Day. Despite the combination antiretroviral therapy, 10-25% of Human Immunodeficiency Virus (HIV)-positive individuals report neurocognitive impairm... Read full blog post. |
Understanding Transcription with RNA Polymerase II RNA polymerase II is a large 12-subunit complex that synthesizes all mRNAs and several non-coding RNAs in eukaryotic cells. It is a DNA-dependent RNA polymerase enzyme that catalyzes transcription of DNA into RNA based on the four ribonucleoside triph... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.