![Immunohistochemistry-Paraffin: IRF4 Antibody [NBP1-82813] - Analysis in human duodenum and kidney tissues. Corresponding IRF4 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/IRF4-Antibody-Immunohistochemistry-NBP1-82813-img0016.jpg "Immunohistochemistry-Paraffin: IRF4 Antibody [NBP1-82813] - Analysis in human duodenum and kidney tissues. Corresponding IRF4 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ALAFSDCRLHICLYYREILVKELTTSSPEGCRISHGHTYDASNLDQVLFPYPEDNGQRKNIEKLLSHLERGVVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRPNKLERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLC |
| Predicted Species | Mouse (93%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IRF4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for IRF4 Antibody (NBP1-82813)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | IRF4 |
![Immunohistochemistry-Paraffin: IRF4 Antibody [NBP1-82813] - Staining of human duodenum, kidney, pancreas and tonsil using Anti-IRF4 antibody NBP1-82813 (A) shows similar protein distribution across tissues to independent antibody NBP1-82814 (B).](http://images.novusbio.com/fullsize/IRF4-Antibody-Immunohistochemistry-Paraffin-NBP1-82813-img0018.jpg "Immunohistochemistry-Paraffin: IRF4 Antibody [NBP1-82813] - Staining of human duodenum, kidney, pancreas and tonsil using Anti-IRF4 antibody NBP1-82813 (A) shows similar protein distribution across tissues to independent antibody NBP1-82814 (B).")
![Western Blot: IRF4 Antibody [NBP1-82813] - Analysis in control (vector only transfected HEK293T lysate) and IRF4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/IRF4-Antibody-Western-Blot-NBP1-82813-img0010.jpg "Western Blot: IRF4 Antibody [NBP1-82813] - Analysis in control (vector only transfected HEK293T lysate) and IRF4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: IRF4 Antibody [NBP1-82813] - Staining of human tonsil shows moderate nuclear positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/IRF4-Antibody-Immunohistochemistry-Paraffin-NBP1-82813-img0022.jpg "Immunohistochemistry-Paraffin: IRF4 Antibody [NBP1-82813] - Staining of human tonsil shows moderate nuclear positivity in non-germinal center cells.")
![Immunohistochemistry-Paraffin: IRF4 Antibody [NBP1-82813] - Staining of human duodenum shows moderate nuclear positivity in lymphoid cells.](http://images.novusbio.com/fullsize/IRF4-Antibody-Immunohistochemistry-Paraffin-NBP1-82813-img0017.jpg "Immunohistochemistry-Paraffin: IRF4 Antibody [NBP1-82813] - Staining of human duodenum shows moderate nuclear positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: IRF4 Antibody [NBP1-82813] - Staining of human kidney shows no positivity in cells in tubules as expected.](http://images.novusbio.com/fullsize/IRF4-Antibody-Immunohistochemistry-Paraffin-NBP1-82813-img0019.jpg "Immunohistochemistry-Paraffin: IRF4 Antibody [NBP1-82813] - Staining of human kidney shows no positivity in cells in tubules as expected.")
![Immunohistochemistry-Paraffin: IRF4 Antibody [NBP1-82813] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/IRF4-Antibody-Immunohistochemistry-Paraffin-NBP1-82813-img0021.jpg "Immunohistochemistry-Paraffin: IRF4 Antibody [NBP1-82813] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neprilysin_AF1126_Immunohistochemistry_6679.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-8220249505976.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-44202415433122.jpg)
![Simple Western Glucosylceramidase/GBA Antibody (812201) [Unconjugated]](https://images.novusbio.com/images2/16239.jpg)
![Western Blot Glucosylceramidase/GBA Antibody (812201) [Unconjugated]](https://images.novusbio.com/images2/Glucosylceramidase_MAB7410_Western_Blot_12708.jpg)
![Immunocytochemistry Glucosylceramidase/GBA Antibody (812201) [Unconjugated]](https://images.novusbio.com/images2/Glucosylceramidase_MAB7410_Immunocytochemistry_12732.jpg)
![Flow Cytometry Pax5/BSAP Antibody (1207C) [Unconjugated]](https://images.novusbio.com/images2/Pax5_MAB3487_Flow_Cytometry_19328.jpg)
![Western Blot Pax5/BSAP Antibody (1207C) [Unconjugated]](https://images.novusbio.com/images2/Pax5_MAB3487_Western_Blot_19363.jpg)
![Immunohistochemistry Pax5/BSAP Antibody (1207C) [Unconjugated]](https://images.novusbio.com/images2/Pax5_MAB3487_Immunohistochemistry_19379.jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![Western Blot MuRF1/TRIM63 Antibody [Unconjugated]](https://images.novusbio.com/images2/MuRF1_AF5366_Western_Blot_5701.jpg)
![Simple Western MuRF1/TRIM63 Antibody [Unconjugated]](https://images.novusbio.com/images2/MuRF1_AF5366_Simple_Western_17120.jpg)
![Western Blot MuRF1/TRIM63 Antibody [Unconjugated]](https://images.novusbio.com/images/af5366_human-mouse-rat-murf1-trim63-affinity-purified-polyclonal-ab-41202412402520.jpg)
![Immunocytochemistry IL-21 Antibody [Unconjugated]](https://images.novusbio.com/images2/IL-21_AF594_Immunocytochemistry_6525.jpg)
![Neutralization IL-21 Antibody [Unconjugated]](https://images.novusbio.com/images2/af594_mouse-il-21-affinity-purified-polyclonal-ab-neutralization-249202192915.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")