Home » IL-20R alpha » IL-20R alpha Proteins » IL-20R alpha Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

IL-20R alpha Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for IL-20R alpha Recombinant Protein Antigen (NBP1-89633PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

IL-20R alpha Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL20RA.

Source: E. coli

Amino Acid Sequence: DYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IL20RA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89633.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IL-20R alpha Recombinant Protein Antigen

  • class II cytokine receptor ZCYTOR7
  • CRF2-8
  • Cytokine receptor class-II member 8
  • Cytokine receptor family 2 member 8
  • FLJ40993
  • IL-20 R alpha
  • IL20R alpha
  • IL-20R alpha
  • IL-20R1
  • IL-20R1IL-20 receptor subunit alpha
  • IL20RA
  • IL-20Ra
  • IL-20R-alpha
  • interleukin 20 receptor, alpha
  • interleukin-20 receptor I
  • interleukin-20 receptor subunit alpha
  • zcytor7

Background

Official Gene Symbol: IL20RA Gene ID: 53832 (Human) Gene Map Locus: 6q22.33-q23.1 (Human) IL20RA, is a subunit of IL20R, a member of Cytokine Class II receptor super family. It consists of a central transmembrane domain and functionally induces IL20 and IL26 signaling in epithelial cells and keratinocytes. It associates with IL-20RB and forms a functional receptor complex for IL20, IL19, and IL24. It also associates with IL-10RB and forms a unique heterodimeric functional receptor complex for IL-26. Upon ligand binding, it induces signaling through activation of STAT3 and STAT1. IL20RA is specifically expressed in skin suggesting a prominent role in growth and proliferation of keratinocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

IL-17F [Biotin]
DY1335B
N/A IL-17F [Biotin]
N/A IL-17F [Biotin]
(13 Publications)
Species: Hu
Applications: ELISA
IL-17B Antibody
[Unconjugated]
AF1709
Intracellular Staining by Flow Cytometry IL-17B Antibody [Unconjugated]
(2 Publications)
Species: Mu
Applications: Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICFlow, WB
IL-20
[Unconjugated]
1102-IL/CF
IL-20 [Unconjugated]
(11 Publications)
Species: Hu
Applications: BA
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(299 Publications)
Species: Mu
Applications: ELISA
IL-24
[Unconjugated]
1965-IL
IL-24 [Unconjugated]
(19 Publications)
Species: Hu
Applications: BA
IL-22
[Unconjugated]
782-IL/CF
SDS-PAGE IL-22 [Unconjugated]
Bioactivity IL-22 [Unconjugated]
(65 Publications)
Species: Hu
Applications: BA
IL-26/AK155
Antibody
AF1375
IL-26/AK155 Antibody
(6 Publications)
Species: Hu
Applications: WB
IL-19 [HRP]
D1900
N/A IL-19 [HRP]
N/A IL-19 [HRP]
(7 Publications)
Species: Hu
Applications: ELISA
IL-19 [HRP]
D1900
N/A IL-19 [HRP]
N/A IL-19 [HRP]
(7 Publications)
Species: Hu
Applications: ELISA
IL-17D Antibody
(246018) [Unconjugate
MAB15041
Immunohistochemistry IL-17D Antibody (246018) [Unconjugated]
Intracellular Staining by Flow Cytometry IL-17D Antibody (246018) [Unconjugated]
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
IL-10 R beta
Antibody (90220) [Unc ...
MAB874
Neutralization IL-10 R beta Antibody (90220) [Unconjugated]
Flow Cytometry IL-10 R beta Antibody (90220) [Unconjugated]
(1 Review)
(9 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
STAT3 Antibody
(232209) [Unconjugate
MAB1799
Knockout Validated STAT3 Antibody (232209) [Unconjugated]
Western Blot STAT3 Antibody (232209) [Unconjugated]
Knockout Validated STAT3 Antibody (232209) [Unconjugated]
(22 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
STAT1 [p Tyr701]
Antibody [Unconjugate ...
AF2894
Western Blot STAT1 [p Tyr701] Antibody [Unconjugated]
Simple Western STAT1 [p Tyr701] Antibody [Unconjugated]
Intracellular Staining by Flow Cytometry STAT1 [p Tyr701] Antibody [Unconjugated]
(1 Review)
(11 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
SOAT1 Antibody
NB400-141
SOAT1 Antibody
(7 Publications)
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
IL-22BP/IL22 RA2
[Unconjugated]
8498-BP
IL-22BP/IL22 RA2 [Unconjugated]
Species: Hu
Applications: BA
IL-10R alpha
Antibody (37607)
MAB274
Neutralization IL-10R alpha Antibody (37607)
(19 Publications)
Species: Hu
Applications: Neut
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(656 Publications)
Species: Mu
Applications: ELISA
IL-20R alpha
Recombinant Protein A ...
NBP1-89633PEP
IL-20R alpha Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for IL-20R alpha Recombinant Protein Antigen (NBP1-89633PEP) (0)

There are no publications for IL-20R alpha Recombinant Protein Antigen (NBP1-89633PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-20R alpha Recombinant Protein Antigen (NBP1-89633PEP) (0)

There are no reviews for IL-20R alpha Recombinant Protein Antigen (NBP1-89633PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IL-20R alpha Recombinant Protein Antigen (NBP1-89633PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-20R alpha Products

Blogs on IL-20R alpha

There are no specific blogs for IL-20R alpha, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IL-20R alpha Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol IL20RA