Home » Ikaros/IKZF1 » Ikaros Peptides and Proteins » Ikaros/IKZF1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Ikaros/IKZF1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Ikaros/IKZF1 Recombinant Protein Antigen (NBP2-38241PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Ikaros/IKZF1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IKZF1.

Source: E. coli

Amino Acid Sequence: SNNEEQRSGLIYLTNHIAPHARNGLSLKEEHRAYDLLRAASENSQDALRVVSTSGEQMKVYKC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IKZF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38241.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Ikaros/IKZF1 Recombinant Protein Antigen

  • DNA-binding protein Ikaros
  • hIk-1
  • IK1
  • IK1LyF-1
  • Ikaros (zinc finger protein)
  • IKAROS family zinc finger 1 (Ikaros)
  • Ikaros family zinc finger protein 1
  • Ikaros
  • IKAROSLymphoid transcription factor LyF-1
  • IKZF1
  • LYF1
  • LyF-1
  • LYF1PRO0758
  • PRO0758
  • zinc finger protein, subfamily 1A, 1 (Ikaros)
  • ZNFN1A1
  • ZNFN1A1CLL-associated antigen KW-6

Background

Transcription regulator of hematopoietic cell differentiation. Binds gamma-satellite DNA. Binds with higher affinity to gamma satellite A. Plays a role in the development of lymphocytes, B- and T-cells. Binds and activates the enhancer (delta-A element) of the CD3-delta gene. Repressor of the TDT (terminal deoxynucleotidyltransferase) gene during thymocyte differentiation. Regulates transcription through association with both HDAC-dependent and HDAC-independent complexes. Targets the 2 chromatin-remodeling complexes, NuRD and BAF (SWI/SNF), in a single complex (PYR complex), to the beta-globin locus in adult erythrocytes. Increases normal apoptosis in adult erythroid cells. Confers early temporal competence to retinal progenitor cells (RPCs)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

RED Antibody
NBP2-20119
Western Blot RED Antibody
Immunohistochemistry-Paraffin RED Antibody
Immunohistochemistry-Paraffin RED Antibody
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Aiolos/IKZF3
Antibody - BSA Free
NBP2-24495
Western Blot Aiolos/IKZF3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Aiolos/IKZF3 Antibody - BSA Free
Western Blot Aiolos/IKZF3 Antibody - BSA Free
(13 Publications)
Species: Hu, Pm
Applications: ICC/IF, IHC, WB
Helios Antibody
(736423) [Unconjugate
MAB73091
Western Blot Helios Antibody (736423) [Unconjugated]
Immunohistochemistry Helios Antibody (736423) [Unconjugated]
Species: Hu
Applications: IHC, WB
Pax5/BSAP Antibody
(1207C) [Unconjugated ...
MAB3487
Flow Cytometry Pax5/BSAP Antibody (1207C) [Unconjugated]
Western Blot Pax5/BSAP Antibody (1207C) [Unconjugated]
Immunohistochemistry Pax5/BSAP Antibody (1207C) [Unconjugated]
(1 Publication)
Species: Hu, Mu
Applications: Flow, ICC, IHC, Simple Western, WB
Jak2 Antibody
(53B7) - BSA Free
NBP2-59451
Flow Cytometry Jak2 Antibody (53B7) - BSA Free
Immunocytochemistry/ Immunofluorescence Jak2 Antibody (53B7) - BSA Free
Western Blot Jak2 Antibody (53B7) - BSA Free
(3 Reviews)
(3 Publications)
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
TCF-3/E2A Antibody
(826927) [Unconjugate ...
MAB7650
Western Blot TCF-3/E2A Antibody (826927) [Unconjugated]
Immunohistochemistry TCF-3/E2A Antibody (826927) [Unconjugated]
(2 Publications)
Species: Mu
Applications: IHC, WB
KCNN4 Antibody
NBP2-33694
Immunohistochemistry-Paraffin KCNN4 Antibody
Immunohistochemistry-Paraffin KCNN4 Antibody
Immunohistochemistry-Paraffin KCNN4 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
EBF-1 Antibody
[Unconjugated]
AF5165
Western Blot EBF-1 Antibody [Unconjugated]
Western Blot EBF-1 Antibody [Unconjugated]
Western Blot EBF-1 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu
Applications: WB
Kir2.1 Antibody
(S112)
NBP2-12900
Immunohistochemistry Kir2.1 Antibody (S112)
Western Blot Kir2.1 Antibody (S112)
Immunohistochemistry Kir2.1 Antibody (S112)
(1 Review)
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, Simple Western, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
PU.1/Spi-1 Antibody
NBP2-27163
Western Blot PU.1/Spi-1 Antibody
Western Blot PU.1/Spi-1 Antibody
Flow Cytometry PU.1/Spi-1 Antibody
(1 Review)
(1 Publication)
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: Flow, WB
GATA-1 Antibody
(4F5) - BSA Free
NBP1-47492
Immunohistochemistry GATA-1 Antibody (4F5) - BSA Free
Immunocytochemistry/ Immunofluorescence GATA-1 Antibody (4F5) - BSA Free
Immunohistochemistry-Paraffin GATA-1 Antibody (4F5) - BSA Free
(1 Review)
(2 Publications)
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
CD34 Antibody
[Unconjugated]
AF4117
Immunohistochemistry CD34 Antibody [Unconjugated]
(3 Reviews)
(37 Publications)
Species: Rt
Applications: IHC, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
TdT Antibody
NBP2-31368
Western Blot TdT Antibody
Immunohistochemistry-Paraffin TdT Antibody
Immunohistochemistry-Paraffin TdT Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Flt-3/Flk-2/CD135
Antibody (66903) [Unc ...
MAB812
Flow Cytometry Flt-3/Flk-2/CD135 Antibody (66903) [Unconjugated]
Flow Cytometry Flt-3/Flk-2/CD135 Antibody (66903) [Unconjugated]
(4 Publications)
Species: Hu
Applications: CyTOF-ready, Flow
Bcl-xL Antibody
NB100-56104
Western Blot Bcl-xL Antibody
Immunohistochemistry-Paraffin Bcl-xL Antibody
Western Blot Bcl-xL Antibody
(1 Review)
(3 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
BCR Antibody
AF5129
Western Blot BCR Antibody
(1 Publication)
Species: Hu
Applications: WB

Publications for Ikaros/IKZF1 Recombinant Protein Antigen (NBP2-38241PEP) (0)

There are no publications for Ikaros/IKZF1 Recombinant Protein Antigen (NBP2-38241PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ikaros/IKZF1 Recombinant Protein Antigen (NBP2-38241PEP) (0)

There are no reviews for Ikaros/IKZF1 Recombinant Protein Antigen (NBP2-38241PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Ikaros/IKZF1 Recombinant Protein Antigen (NBP2-38241PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ikaros/IKZF1 Products

Research Areas for Ikaros/IKZF1 Recombinant Protein Antigen (NBP2-38241PEP)

Find related products by research area.

Blogs on Ikaros/IKZF1

There are no specific blogs for Ikaros/IKZF1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunohistochemistry-Frozen: CD4 Antibody [NBP1-19371] - Staining in mouse liver tissue.
CD4 Antibody - BSA Free
NBP1-19371
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
p19ARF/CDKN2A Antibody - BSA Free
NB200-106

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Ikaros/IKZF1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol IKZF1