| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC, KO |
| Clone | 7H7W10 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-265 of human Heme Oxygenase 1 (HO-1/HMOX1) (NP_002124.1). MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQA |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | HMOX1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for HO-1/HMOX1/HSP32 Antibody (NBP3-15640)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HMOX1 |
![HO-1/HMOX1/HSP32 Antibody (3L2U4) [NBP3-15640] - Analysis of extracts of HepG2 cells, using Heme Oxygenase 1 (HO-1/HMOX1) antibody at 1:10000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.](http://images.novusbio.com/fullsize/nbp3-15640_rabbit-ho-1-hmox1-hsp32-mab-3l2u4-western-blot-45202375028..jpg "HO-1/HMOX1/HSP32 Antibody (3L2U4) [NBP3-15640] - Analysis of extracts of HepG2 cells, using Heme Oxygenase 1 (HO-1/HMOX1) antibody at 1:10000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.")
![HO-1/HMOX1/HSP32 Antibody (3L2U4) [NBP3-15640] -Analysis of extracts from wild type(WT) and Heme Oxygenase 1 (HO-1/HMOX1) knockout (KO) HeLa cells, using Heme Oxygenase 1 (HO-1/HMOX1) antibody at 1:10000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.](http://images.novusbio.com/fullsize/nbp3-15640_rabbit-ho-1-hmox1-hsp32-mab-3l2u4-knockout-validated-45202375233..jpg "HO-1/HMOX1/HSP32 Antibody (3L2U4) [NBP3-15640] -Analysis of extracts from wild type(WT) and Heme Oxygenase 1 (HO-1/HMOX1) knockout (KO) HeLa cells, using Heme Oxygenase 1 (HO-1/HMOX1) antibody at 1:10000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.")
![Immunohistochemistry-Paraffin: HO-1/HMOX1/HSP32 Antibody (3L2U4) [NBP3-15640] -Analysis of human colon using [KD Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb at dilution of 1:200 (40x lens) .Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/nbp3-15640_rabbit-ho-1-hmox1-hsp32-mab-7h7w10-immunohistochemistry-paraffin-23720241236..jpg "Immunohistochemistry-Paraffin: HO-1/HMOX1/HSP32 Antibody (3L2U4) [NBP3-15640] -Analysis of human colon using [KD Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb at dilution of 1:200 (40x lens) .Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: HO-1/HMOX1/HSP32 Antibody (3L2U4) [NBP3-15640] -Human spleen using [KD Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/nbp3-15640_rabbit-ho-1-hmox1-hsp32-mab-7h7w10-immunohistochemistry-paraffin-237202412427..jpg "Immunohistochemistry-Paraffin: HO-1/HMOX1/HSP32 Antibody (3L2U4) [NBP3-15640] -Human spleen using [KD Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![N/A IL-10 [Biotin]](https://images.novusbio.com/images2/DATA_IL10_DY417_ELISA_2014.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")