![Immunohistochemistry-Paraffin: Hexokinase Type III Antibody [NBP2-38799] - Analysis in human bone marrow and kidney tissues using NBP2-38799 antibody. Corresponding HK3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/antibody/nbp2-38799_rabbit-polyclonal-hexokinase-type-iii-antibody-immunohistochemistry-paraffin-13720231080..jpg "Immunohistochemistry-Paraffin: Hexokinase Type III Antibody [NBP2-38799] - Analysis in human bone marrow and kidney tissues using NBP2-38799 antibody. Corresponding HK3 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MDSIGSSGLRQGEETLSCSEEGLPGPSDSSELVQECLQQFKVTRAQLQQIQASLLGSMEQA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HK3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Hexokinase Type III Antibody (NBP2-38799)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Hexokinase Type III Antibody [NBP2-38799] - Staining of human bone marrow shows high expression.](http://images.novusbio.com/fullsize/Hexokinase-Type-III-Antibody-Immunohistochemistry-Paraffin-NBP2-38799-img0004.jpg "Immunohistochemistry-Paraffin: Hexokinase Type III Antibody [NBP2-38799] - Staining of human bone marrow shows high expression.")
![Western Blot: Hexokinase Type III Antibody [NBP2-38799] -Analysis in human spleen tissue.](http://images.novusbio.com/fullsize/antibody/nbp2-38799_rabbit-polyclonal-hexokinase-type-iii-antibody-western-blot-137202310614..jpg "Western Blot: Hexokinase Type III Antibody [NBP2-38799] -Analysis in human spleen tissue.")
![Immunohistochemistry-Paraffin: Hexokinase Type III Antibody [NBP2-38799] -Staining of human lymphoid tissues shows strong cytoplasmic positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/antibody/nbp2-38799_rabbit-polyclonal-hexokinase-type-iii-antibody-immunohistochemistry-paraffin-137202310926..jpg "Immunohistochemistry-Paraffin: Hexokinase Type III Antibody [NBP2-38799] -Staining of human lymphoid tissues shows strong cytoplasmic positivity in non-germinal center cells.")
![Immunohistochemistry-Paraffin: Hexokinase Type III Antibody [NBP2-38799] -Staining of human colon shows strong cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/fullsize/antibody/nbp2-38799_rabbit-polyclonal-hexokinase-type-iii-antibody-immunohistochemistry-paraffin-1372023101029..jpg "Immunohistochemistry-Paraffin: Hexokinase Type III Antibody [NBP2-38799] -Staining of human colon shows strong cytoplasmic positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: Hexokinase Type III Antibody [NBP2-38799] -Staining of human skin shows negative cytoplasmic positivity in squamous epithelial cells as expected.](http://images.novusbio.com/fullsize/antibody/nbp2-38799_rabbit-polyclonal-hexokinase-type-iii-antibody-immunohistochemistry-paraffin-1372023101156..jpg "Immunohistochemistry-Paraffin: Hexokinase Type III Antibody [NBP2-38799] -Staining of human skin shows negative cytoplasmic positivity in squamous epithelial cells as expected.")
![Immunohistochemistry-Paraffin: Hexokinase Type III Antibody [NBP2-38799] -Staining of human kidney shows negative cytoplasmic positivity in cells in tubules and cells in glomeruli as expected.](http://images.novusbio.com/fullsize/antibody/nbp2-38799_rabbit-polyclonal-hexokinase-type-iii-antibody-immunohistochemistry-paraffin-137202310131..jpg "Immunohistochemistry-Paraffin: Hexokinase Type III Antibody [NBP2-38799] -Staining of human kidney shows negative cytoplasmic positivity in cells in tubules and cells in glomeruli as expected.")
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_729.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_730.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/Kallikrein_3_DKK300_ELISA_124.jpg)
![Western Blot Protein S/PROS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protein_S_AF4036_Western_Blot_17082.jpg)
![Simple Western Protein S/PROS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protein_S_AF4036_Simple_Western_18689.jpg)
![Kallikrein 1 Antibody (323803) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Kallikrein 1 Antibody (323803) [Unconjugated]")
![Enzyme Activity Kallikrein 14 [Unconjugated]](https://images.novusbio.com/images2/Kallikrein_14_2626SE_1840.jpg)
![Intracellular Staining by Flow Cytometry Serpin A5/Protein C Inhibitor Antibody (210326) [Unconjugated]](https://images.novusbio.com/images/antibody/mab1266_human-serpin-a5-mab-clone-210326-intracellular-staining-by-flow-cytometry-662020192248.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")