Hemoglobin epsilon Antibody - BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human Hemoglobin epsilon (NP_005321.1). MVHFTAEEKAAVTSLWSKMNVEEAGGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPKVKAHGKKVLTSFGDAIKNMDNLKPAFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPEVQAAWQKLVSAVAIALAHKYH |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
HBE1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Western Blot 1:500-1:2000
|
Theoretical MW |
16 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Hemoglobin epsilon Antibody - BSA Free
Background
The epsilon globin gene (HBE) is normally expressed in the embryonic yolk sac: two epsilon chains together with twozeta chains (an alpha-like globin) constitute the embryonic hemoglobin Hb Gower I; two epsilon chains together withtwo alpha chains form the embryonic Hb Gower II. Both of these embryonic hemoglobins are normally supplanted by fetal,and later, adult hemoglobin. The five beta-like globin genes are found within a 45 kb cluster on chromosome 11 in thefollowing order: 5'-epsilon - G-gamma - A-gamma - delta - beta-3' (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ChIP, ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Publications for Hemoglobin epsilon Antibody (NBP3-03279) (0)
There are no publications for Hemoglobin epsilon Antibody (NBP3-03279).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Hemoglobin epsilon Antibody (NBP3-03279) (0)
There are no reviews for Hemoglobin epsilon Antibody (NBP3-03279).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Hemoglobin epsilon Antibody (NBP3-03279) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Hemoglobin epsilon Products
Research Areas for Hemoglobin epsilon Antibody (NBP3-03279)
Find related products by research area.
|
Blogs on Hemoglobin epsilon