![Western Blot: GM130/GOLGA2 Antibody [NBP1-89757] - Analysis using Anti-GOLGA2 antibody NBP1-89757 (A) shows similar pattern to independent antibody NBP1-89756 (B).](http://images.novusbio.com/fullsize/GM130-GOLGA2-Antibody-Western-Blot-NBP1-89757-img0017.jpg "Western Blot: GM130/GOLGA2 Antibody [NBP1-89757] - Analysis using Anti-GOLGA2 antibody NBP1-89757 (A) shows similar pattern to independent antibody NBP1-89756 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DTPKDNAATLQPSDDTVLPGGVPSPGASLTSMAASQNHDADNVPNLMDETKTFSSTESLRQLSQQLNGLVCESATCVNGEGPASSANLK |
| Marker | Golgi Apparatus Marker |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GOLGA2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Syntaxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin_5_AF5687_Simple_Western_20944.jpg)
![Western Blot Syntaxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin_5_AF5687_Western_Blot_5806.jpg)
![Immunohistochemistry Syntaxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin_5_AF5687_Immunohistochemistry_19570.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for GM130/GOLGA2 Antibody (NBP1-89757)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GOLGA2 |
![Immunocytochemistry/Immunofluorescence: GM130/GOLGA2 Antibody [NBP1-89757] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/GM130-GOLGA2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89757-img0012.jpg "Immunocytochemistry/Immunofluorescence: GM130/GOLGA2 Antibody [NBP1-89757] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus. Antibody staining is shown in green.")
![Immunohistochemistry: GM130/GOLGA2 Antibody [NBP1-89757] - Immunohistochemical staining of human lymph node shows low expression as expected.](http://images.novusbio.com/fullsize/GM130-GOLGA2-Antibody-Immunohistochemistry-NBP1-89757-img0023.jpg "Immunohistochemistry: GM130/GOLGA2 Antibody [NBP1-89757] - Immunohistochemical staining of human lymph node shows low expression as expected.")
![Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody [NBP1-89757] - Staining of human parathyroid gland shows high expression.](http://images.novusbio.com/fullsize/GM130-GOLGA2-Antibody-Immunohistochemistry-Paraffin-NBP1-89757-img0014.jpg "Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody [NBP1-89757] - Staining of human parathyroid gland shows high expression.")
![Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody [NBP1-89757] - Staining in human parathyroid gland and lymph node tissues using anti-GOLGA2 antibody. Corresponding GOLGA2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/GM130-GOLGA2-Antibody-Immunohistochemistry-Paraffin-NBP1-89757-img0015.jpg "Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody [NBP1-89757] - Staining in human parathyroid gland and lymph node tissues using anti-GOLGA2 antibody. Corresponding GOLGA2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody [NBP1-89757] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-GOLGA2 antibody NBP1-89757 (A) shows similar protein distribution across tissues to independent antibody NBP1-89756 (B).](http://images.novusbio.com/fullsize/GM130-GOLGA2-Antibody-Immunohistochemistry-Paraffin-NBP1-89757-img0016.jpg "Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody [NBP1-89757] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-GOLGA2 antibody NBP1-89757 (A) shows similar protein distribution across tissues to independent antibody NBP1-89756 (B).")
![Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody [NBP1-89757] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/GM130-GOLGA2-Antibody-Immunohistochemistry-Paraffin-NBP1-89757-img0018.jpg "Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody [NBP1-89757] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody [NBP1-89757] - Staining of human testis.](http://images.novusbio.com/fullsize/GM130-GOLGA2-Antibody-Immunohistochemistry-Paraffin-NBP1-89757-img0019.jpg "Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody [NBP1-89757] - Staining of human testis.")
![Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody [NBP1-89757] - Staining of human colon.](http://images.novusbio.com/fullsize/GM130-GOLGA2-Antibody-Immunohistochemistry-Paraffin-NBP1-89757-img0020.jpg "Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody [NBP1-89757] - Staining of human colon.")
![Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody [NBP1-89757] - Staining of human lymph node using Anti-GOLGA2 antibody NBP1-89757.](http://images.novusbio.com/fullsize/GM130-GOLGA2-Antibody-Immunohistochemistry-Paraffin-NBP1-89757-img0022.jpg "Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody [NBP1-89757] - Staining of human lymph node using Anti-GOLGA2 antibody NBP1-89757.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")