![Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining in human spleen and cerebral cortex tissues using anti-ARHGAP4 antibody. Corresponding ARHGAP4 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ARHGAP4-Antibody-Immunohistochemistry-Paraffin-NBP1-88527-img0012.jpg "Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining in human spleen and cerebral cortex tissues using anti-ARHGAP4 antibody. Corresponding ARHGAP4 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EHNGMRGLIPHKYITLPAGTEKQVVGAGLQTAGESGSSPEGLLASELVHRPEPCTSPEAMGPSGHRRRCLVPASPEQHVEVDKAVAQNMDSVFKELLGKTSVRQGLGPASTTSP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ARHGAP4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
| Publication using NBP1-88527 | Applications | Species |
|---|---|---|
| Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013 Apr [PMID: 23435261] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ARHGAP4 |
![Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human colon, liver, lymph node and testis using Anti-ARHGAP4 antibody NBP1-88527 (A) shows similar protein distribution across tissues to independent antibody NBP1-88528 (B).](http://images.novusbio.com/fullsize/ARHGAP4-Antibody-Immunohistochemistry-Paraffin-NBP1-88527-img0013.jpg "Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human colon, liver, lymph node and testis using Anti-ARHGAP4 antibody NBP1-88527 (A) shows similar protein distribution across tissues to independent antibody NBP1-88528 (B).")
![Western Blot: ARHGAP4 Antibody [NBP1-88527] - Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.](http://images.novusbio.com/fullsize/ARHGAP4-Antibody-Western-Blot-NBP1-88527-img0009.jpg "Western Blot: ARHGAP4 Antibody [NBP1-88527] - Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.")
![Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human colon.](http://images.novusbio.com/fullsize/ARHGAP4-Antibody-Immunohistochemistry-Paraffin-NBP1-88527-img0016.jpg "Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human colon.")
![Western Blot: ARHGAP4 Antibody [NBP1-88527] - Analysis in human cell line RPMI-8226.](http://images.novusbio.com/fullsize/ARHGAP4-Antibody-Western-Blot-NBP1-88527-img0007.jpg "Western Blot: ARHGAP4 Antibody [NBP1-88527] - Analysis in human cell line RPMI-8226.")
![Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human cerebral cortex shows low expression as expected.](http://images.novusbio.com/fullsize/ARHGAP4-Antibody-Immunohistochemistry-Paraffin-NBP1-88527-img0010.jpg "Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human cerebral cortex shows low expression as expected.")
![Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human spleen shows high expression.](http://images.novusbio.com/fullsize/ARHGAP4-Antibody-Immunohistochemistry-Paraffin-NBP1-88527-img0011.jpg "Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human spleen shows high expression.")
![Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human liver.](http://images.novusbio.com/fullsize/ARHGAP4-Antibody-Immunohistochemistry-Paraffin-NBP1-88527-img0014.jpg "Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human liver.")
![Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human lymph node.](http://images.novusbio.com/fullsize/ARHGAP4-Antibody-Immunohistochemistry-Paraffin-NBP1-88527-img0015.jpg "Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human testis.](http://images.novusbio.com/fullsize/ARHGAP4-Antibody-Immunohistochemistry-Paraffin-NBP1-88527-img0017.jpg "Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human testis.")
![Complement Component C2 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Complement Component C2 Antibody [Unconjugated]")
![N/A Complement Component C5a [Biotin]](https://images.novusbio.com/images2/DATA_Complement_Component_C5a_DY2037_ELISA_1753.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")