![Western Blot: GATD3A Antibody [NBP3-03727] - Analysis of extracts of various cell lines, using GATD3A antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit.](http://images.novusbio.com/fullsize/GATD3A-Antibody-Western-Blot-NBP3-03727-img0002.jpg "Western Blot: GATD3A Antibody [NBP3-03727] - Analysis of extracts of various cell lines, using GATD3A antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 42-268 of human GATD3A (NP_004640.4). AARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDLANLSAANHDAAIFPGGFGAAKNLSTFAVDGKDCKVNKEVERVLKEFHQAGKPIGLCCIAPVLAAKVLRGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GATD3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS with 50% glycerol, pH7.3. |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GATD3 |
![Immunocytochemistry/Immunofluorescence: GATD3A Antibody [NBP3-03727] - Analysis of U2OS cells using GATD3A antibody .](http://images.novusbio.com/fullsize/GATD3A-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03727-img0001.jpg "Immunocytochemistry/Immunofluorescence: GATD3A Antibody [NBP3-03727] - Analysis of U2OS cells using GATD3A antibody .")
![Immunohistochemistry ASCL1/Mash1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2567_mouse-ascl1-mash1-affinity-purified-polyclonal-ab-immunohistochemistry-1732021122114.jpg)
![Immunocytochemistry Notch-4 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3847_human-notch-4-intracellular-domain-affinity-purified-pab-immunocytochemistry-3092021102949.jpg)
![Immunohistochemistry Notch-2 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3735_human-notch-2-intracellular-domain-affinity-purified-pab-immunohistochemistry-1862024111356..jpg)
![Western Blot Neurogenin-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neurogenin-3_AF3444_Western_Blot_5300.jpg)
![Immunohistochemistry Neurogenin-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3444_human-neurogenin-3-affinity-purified-polyclonal-ab-immunohistochemistry-192021141921.jpg)
![Bioactivity Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464SH_2840.jpg)
![SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464-SH_341.jpg)
![SEC-MALS Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images/464-sh_recombinant-mouse-sonic-hedgehog-shh-c25ii-n-terminus-sec-mals-642023224324.jpg)
![Immunohistochemistry DLL1 Antibody [Unconjugated]](https://images.novusbio.com/images2/DLL1_AF3970_Immunohistochemistry_6817.jpg)
![Flow Cytometry DLL1 Antibody [Unconjugated]](https://images.novusbio.com/images2/DLL1_AF3970_Flow_Cytometry_9303.jpg)
![Immunocytochemistry/ Immunofluorescence DLL1 Antibody [Unconjugated]](https://images.novusbio.com/images/af3970_mouse-rat-dll1-affinity-purified-polyclonal-ab-41202412403596.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")