Home » FHL3 » FHL3 Proteins » FHL3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

FHL3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for FHL3 Protein (NBP1-91899PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

FHL3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FHL3.

Source: E. coli

Amino Acid Sequence: CNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FHL3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91899.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FHL3 Recombinant Protein Antigen

  • FHL-3
  • four and a half LIM domains 3
  • four and a half LIM domains protein 3
  • LIM-only protein FHL3
  • MGC19547
  • MGC8696
  • Skeletal muscle LIM-protein 2
  • SLIM-2
  • SLIM2MGC23614

Background

LIM proteins are defined by the possession of a highly conserved double zinc finger motif called the LIM domain.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

UNC13D/Munc 13-4
Antibody
NB100-41385
Knockdown Validated UNC13D/Munc 13-4 Antibody
Knockdown Validated UNC13D/Munc 13-4 Antibody
Immunohistochemistry-Paraffin UNC13D/Munc 13-4 Antibody
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, PEP-ELISA, WB
FHL2 Antibody
NBP1-84978
Immunocytochemistry/ Immunofluorescence FHL2 Antibody
Immunohistochemistry-Paraffin FHL2 Antibody
Immunohistochemistry-Paraffin FHL2 Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
STX11 Antibody
NBP1-86122
Western Blot STX11 Antibody
Western Blot STX11 Antibody
Immunohistochemistry-Paraffin STX11 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Syntaxin-BP2
Antibody
AF5900
Western Blot Syntaxin-BP2 Antibody
Species: Hu
Applications: WB
FHL1 Antibody
(767418)
MAB5938
Western Blot FHL1 Antibody (767418)
Immunocytochemistry FHL1 Antibody (767418)
(3 Publications)
Species: Hu
Applications: ICC, WB
PDLIM5 Antibody
NBP1-84843
Immunocytochemistry/ Immunofluorescence PDLIM5 Antibody
Immunohistochemistry-Paraffin PDLIM5 Antibody
Immunohistochemistry-Paraffin PDLIM5 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Complement Factor
H Antibody [Unconjuga ...
AF4779
Immunohistochemistry Complement Factor H Antibody [Unconjugated]
(1 Review)
(2 Publications)
Species: Hu
Applications: IHC, WB
Zinc finger
protein 395 Antibody
NBP3-17459
Immunocytochemistry/ Immunofluorescence Zinc finger protein 395 Antibody
Western Blot Zinc finger protein 395 Antibody
Immunohistochemistry-Paraffin Zinc finger protein 395 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Perforin Antibody
(CB5.4) - BSA Free
NBP1-97512
Western Blot Perforin Antibody (CB5.4) - BSA Free
(7 Publications)
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
FHL5 Antibody
NBP1-32660
Immunocytochemistry/ Immunofluorescence FHL5 Antibody
Immunohistochemistry-Paraffin FHL5 Antibody
Western Blot FHL5 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CBP/KAT3A Antibody
(257003) [Unconjugate ...
MAB2676
Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]
Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
Rab27a Antibody
(1G7)
H00005873-M02
Western Blot Rab27a Antibody (1G7)
Immunohistochemistry-Paraffin Rab27a Antibody (1G7)
Western Blot Rab27a Antibody (1G7)
(13 Publications)
Species: Hu, Mu, Rb
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, S-ELISA, WB
Angiogenin [HRP]
DAN00
N/A Angiogenin [HRP]
N/A Angiogenin [HRP]
(23 Publications)
Species: Hu
Applications: ELISA
LPP Antibody
NBP1-89549
Immunohistochemistry-Paraffin LPP Antibody
Immunohistochemistry-Paraffin LPP Antibody
Immunocytochemistry/ Immunofluorescence LPP Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
nNOS Antibody
NB100-858
Immunocytochemistry/ Immunofluorescence nNOS Antibody
Flow Cytometry nNOS Antibody
Immunocytochemistry/ Immunofluorescence nNOS Antibody
(1 Review)
(15 Publications)
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
PDLIM7 Antibody
NBP1-84841
Immunohistochemistry-Paraffin PDLIM7 Antibody
Immunocytochemistry/ Immunofluorescence PDLIM7 Antibody
Western Blot PDLIM7 Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MZF1 Antibody
(PCRP-MZF1-1E8)
NBP3-23849
Immunohistochemistry-Paraffin MZF1 Antibody (PCRP-MZF1-1E8)
Protein Array MZF1 Antibody (PCRP-MZF1-1E8)
Flow Cytometry MZF1 Antibody (PCRP-MZF1-1E8)
Species: Hu
Applications: Flow, ICC/IF, IHC-P
PDLIM4 Antibody
NBP1-80833
Immunocytochemistry/ Immunofluorescence PDLIM4 Antibody
Western Blot PDLIM4 Antibody
Immunohistochemistry-Paraffin PDLIM4 Antibody
(4 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PAG1 Antibody
(504004) [Unconjugate
MAB5285
Simple Western PAG1 Antibody (504004) [Unconjugated]
Western Blot PAG1 Antibody (504004) [Unconjugated]
(1 Publication)
Species: Hu
Applications: Simple Western, WB
FHL3 Recombinant
Protein Antigen
NBP1-91899PEP
FHL3 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for FHL3 Protein (NBP1-91899PEP) (0)

There are no publications for FHL3 Protein (NBP1-91899PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FHL3 Protein (NBP1-91899PEP) (0)

There are no reviews for FHL3 Protein (NBP1-91899PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FHL3 Protein (NBP1-91899PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FHL3 Products

Research Areas for FHL3 Protein (NBP1-91899PEP)

Find related products by research area.

Blogs on FHL3

There are no specific blogs for FHL3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: nNOS Antibody [NB100-858] - Immunofluorescence analysis of paraformaldehyde fixed HeLa cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing membrane, cytoplasmic and nuclear staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
nNOS Antibody
NB100-858

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FHL3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol FHL3