Home » ERAS » ERAS Proteins » Recombinant Human ERAS GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human ERAS GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human ERAS GST (N-Term) Protein Summary

Description
Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-233 of Human ERAS

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MELPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGCSVA
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ERAS
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
51.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ERAS GST (N-Term) Protein

  • Embryonic stem cell-expressed Ras
  • E-Ras
  • ES cell expressed Ras
  • HRAS2MGC126693
  • HRASPGTPase ERas
  • MGC126691
  • small GTPase protein E-Ras
  • v-Ha-ras Harvey rat sarcoma viral oncogene homolog 2
  • v-Ha-ras Harvey rat sarcoma viral oncogene homolog pseudogene

Background

ERAS belongs to the small GTPase superfamily. Ras family. Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. The ERas gene is expressed in embryonic stem (ES) cells and promotes their in vitro proliferation and tumorigenicity. ERas-null ES cells maintain pluripotency but show significantly reduced growth and tumorigenicity, which are rescued by expression of ERas complementary DNA or by activated phosphatidylinositol-3-OH kinase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Oct-3/4 Antibody
[Unconjugated]
AF1759
Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]
Immunocytochemistry Oct-3/4 Antibody [Unconjugated]
Simple Western Oct-3/4 Antibody [Unconjugated]
(77 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
SOX2 Antibody
[Unconjugated]
AF2018
Western Blot SOX2 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) SOX2 Antibody [Unconjugated]
Simple Western SOX2 Antibody [Unconjugated]
(6 Reviews)
(369 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
Nanog Antibody
[Unconjugated]
AF1997
Chromatin Immunoprecipitation (ChIP) Nanog Antibody [Unconjugated]
Immunocytochemistry Nanog Antibody [Unconjugated]
Immunocytochemistry Nanog Antibody [Unconjugated]
(5 Reviews)
(309 Publications)
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
Arylsulfatase
A/ARSA Antibody
NBP1-00154
Immunohistochemistry-Paraffin Arylsulfatase A/ARSA Antibody
Immunohistochemistry-Paraffin Arylsulfatase A/ARSA Antibody
Western Blot Arylsulfatase A/ARSA Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NANOGP8 Antibody
H00388112-B01P
Western Blot NANOGP8 Antibody
Species: Hu
Applications: WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
LIF [Unconjugated]
7734-LF
LIF [Unconjugated]
(31 Publications)
Species: Hu
Applications: BA
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Frozen ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Paraffin ER alpha/NR3A1 Antibody (33)
(1 Review)
(10 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
GTP binding
protein era homolog A ...
NBP1-89703
Western Blot GTP binding protein era homolog Antibody
Immunocytochemistry/ Immunofluorescence GTP binding protein era homolog Antibody
Immunohistochemistry-Paraffin GTP binding protein era homolog Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
STAT3 Antibody
(232209) [Unconjugate
MAB1799
Knockout Validated STAT3 Antibody (232209) [Unconjugated]
Western Blot STAT3 Antibody (232209) [Unconjugated]
Knockout Validated STAT3 Antibody (232209) [Unconjugated]
(23 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
Aprataxin Antibody
NBP2-98661
Immunocytochemistry/ Immunofluorescence Aprataxin Antibody
Immunohistochemistry-Paraffin Aprataxin Antibody
Western Blot Aprataxin Antibody
Species: Hu
Applications: ICC/IF, IHC-P, WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(46 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
VASA Antibody
[Unconjugated]
AF2030
Western Blot VASA Antibody [Unconjugated]
Immunohistochemistry VASA Antibody [Unconjugated]
Immunohistochemistry VASA Antibody [Unconjugated]
(57 Publications)
Species: Hu
Applications: IHC, WB
SLC22A3 Antibody
NBP1-83976
Immunohistochemistry-Paraffin SLC22A3 Antibody
Immunohistochemistry-Paraffin SLC22A3 Antibody
Immunohistochemistry-Paraffin SLC22A3 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
C-Reactive
Protein/CRP [Biotin]
DY1707
N/A C-Reactive Protein/CRP [Biotin]
(68 Publications)
Species: Hu
Applications: ELISA
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(662 Publications)
Species: Mu
Applications: ELISA
TLE1 Antibody
(OTI1H2)
NBP2-46134
Flow Cytometry TLE1 Antibody (OTI1H2)
Immunofluorescence TLE1 Antibody (OTI1H2)
Immunohistochemistry TLE1 Antibody (OTI1H2)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
p57 Kip2 Antibody
NBP1-89917
Immunohistochemistry-Paraffin p57 Kip2 Antibody
Immunohistochemistry-Paraffin p57 Kip2 Antibody
Immunohistochemistry-Paraffin p57 Kip2 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
KLF4 Antibody
[Unconjugated]
AF3158
Chromatin Immunoprecipitation (ChIP) KLF4 Antibody [Unconjugated]
Immunocytochemistry KLF4 Antibody [Unconjugated]
Immunohistochemistry KLF4 Antibody [Unconjugated]
(2 Reviews)
(88 Publications)
Species: Mu
Applications: ChIP, ICC, IHC, WB
Recombinant Human
ERAS GST (N-Term) Pro ...
H00003266-P01
Recombinant Human ERAS GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for ERAS Recombinant Protein (H00003266-P01) (0)

There are no publications for ERAS Recombinant Protein (H00003266-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERAS Recombinant Protein (H00003266-P01) (0)

There are no reviews for ERAS Recombinant Protein (H00003266-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ERAS Recombinant Protein (H00003266-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ERAS Products

Research Areas for ERAS Recombinant Protein (H00003266-P01)

Find related products by research area.

Blogs on ERAS

There are no specific blogs for ERAS, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows lysates of D3 mouse embryonic stem cell line, NTera-2 human testicular embryonic carcinoma cell line, F9 mouse teratocarcinoma stem cells, and rat cortical stem cells. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat SOX2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2018) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (HAF017). A specific band was detected for SOX2 at approximately 36 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
SOX2 Antibody [Unconjugated]
AF2018
BG01V human embryonic stem cells were fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. Nanog/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human Nanog Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1997) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The nanog promoter was detected by standard PCR.
Nanog Antibody [Unconjugated]
AF1997

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ERAS GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol ERAS