![Immunohistochemistry-Paraffin: p57 Kip2 Antibody [NBP1-89917] - Staining in human placenta and colon tissues using anti-CDKN1C antibody. Corresponding CDKN1C RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/p57-Kip2-Antibody-Immunohistochemistry-Paraffin-NBP1-89917-img0014.jpg "Immunohistochemistry-Paraffin: p57 Kip2 Antibody [NBP1-89917] - Staining in human placenta and colon tissues using anti-CDKN1C antibody. Corresponding CDKN1C RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CDKN1C |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Western_Blot_11082.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11144.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11480.jpg)
| Publication using NBP1-89917 | Applications | Species |
|---|---|---|
| Mochizuki M, Tamai K, Imai T et al. CD271 regulates the proliferation and motility of hypopharyngeal cancer cells. Sci Rep. 2016-07-29 [PMID: 27469492] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for p57 Kip2 Antibody (NBP1-89917)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CDKN1C |
![Western Blot: p57 Kip2 Antibody [NBP1-89917] - Analysis in human placenta tissue.](http://images.novusbio.com/fullsize/p57-Kip2-Antibody-Western-Blot-NBP1-89917-img0015.jpg "Western Blot: p57 Kip2 Antibody [NBP1-89917] - Analysis in human placenta tissue.")
![Immunocytochemistry/Immunofluorescence: p57 Kip2 Antibody [NBP1-89917] - Staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear bodies & cytosol.](http://images.novusbio.com/fullsize/p57-Kip2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89917-img0011.jpg "Immunocytochemistry/Immunofluorescence: p57 Kip2 Antibody [NBP1-89917] - Staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear bodies & cytosol.")
![Immunohistochemistry-Paraffin: p57 Kip2 Antibody [NBP1-89917] - Staining of human colon shows low expression as expected.](http://images.novusbio.com/fullsize/p57-Kip2-Antibody-Immunohistochemistry-Paraffin-NBP1-89917-img0012.jpg "Immunohistochemistry-Paraffin: p57 Kip2 Antibody [NBP1-89917] - Staining of human colon shows low expression as expected.")
![Immunohistochemistry-Paraffin: p57 Kip2 Antibody [NBP1-89917] - Staining of human placenta shows high expression.](http://images.novusbio.com/fullsize/p57-Kip2-Antibody-Immunohistochemistry-Paraffin-NBP1-89917-img0013.jpg "Immunohistochemistry-Paraffin: p57 Kip2 Antibody [NBP1-89917] - Staining of human placenta shows high expression.")
![Western Blot p27/Kip1 [p Thr157] Antibody](https://images.novusbio.com/images2/p27_AF1555_Western_Blot_5119.jpg)
![SDS-PAGE IGF-II/IGF2 [Unconjugated]](https://images.novusbio.com/images2/IGF-II_292-G2_668.jpg)
![Bioactivity IGF-II/IGF2 [Unconjugated]](https://images.novusbio.com/images2/IGF-II_292-G2_669.jpg)
![Western Blot CIB1 Antibody (791119) [Unconjugated]](https://images.novusbio.com/images2/CIB1_MAB7557_Western_Blot_13865.jpg)
![Immunohistochemistry CIB1 Antibody (791119) [Unconjugated]](https://images.novusbio.com/images2/CIB1_MAB7557_Immunohistochemistry_13917.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")