![Immunohistochemistry-Paraffin: EED Antibody [NBP2-38907] - Staining in human tonsil and pancreas tissues.. Corresponding EED RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/EED-Antibody-Immunohistochemistry-Paraffin-NBP2-38907-img0006.jpg "Immunohistochemistry-Paraffin: EED Antibody [NBP2-38907] - Staining in human tonsil and pancreas tissues.. Corresponding EED RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLK |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | EED |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for EED Antibody (NBP2-38907)Find related products by research area.
|
|
Microglia: pruning shears for homeostatic maintenance in the brain By Jennifer Sokolowski, MD, PhD.Microglia play a critical role in pruning neurons and synapses during homeostatic maintenance in the adult brain.1 A recent study by Ayata et al. (2018) identified regional differe... Read full blog post. |
|
EZH1 has more to offer than gene repression EZH1 is part of the Polycomb-group family of proteins, which are responsible for remodeling chromatin in genes and modulating epigenetic silencing during development. Specifically, EZHI is a component of PRC2, or polycomb repressive complex-2. PR... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: EED Antibody [NBP2-38907] - Analysis using Anti-EED antibody NBP2-38907 (A) shows similar pattern to independent antibody NBP2-57195 (B).](http://images.novusbio.com/fullsize/EED-Antibody-Western-Blot-NBP2-38907-img0010.jpg "Western Blot: EED Antibody [NBP2-38907] - Analysis using Anti-EED antibody NBP2-38907 (A) shows similar pattern to independent antibody NBP2-57195 (B).")
![Immunohistochemistry-Paraffin: EED Antibody [NBP2-38907] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/EED-Antibody-Immunohistochemistry-Paraffin-NBP2-38907-img0009.jpg "Immunohistochemistry-Paraffin: EED Antibody [NBP2-38907] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: EED Antibody [NBP2-38907] - Staining of human tonsil shows strong nuclear positivity in germinal center cells.](http://images.novusbio.com/fullsize/EED-Antibody-Immunohistochemistry-Paraffin-NBP2-38907-img0005.jpg "Immunohistochemistry-Paraffin: EED Antibody [NBP2-38907] - Staining of human tonsil shows strong nuclear positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: EED Antibody [NBP2-38907] - Staining of human pancreas shows no positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/EED-Antibody-Immunohistochemistry-Paraffin-NBP2-38907-img0007.jpg "Immunohistochemistry-Paraffin: EED Antibody [NBP2-38907] - Staining of human pancreas shows no positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: EED Antibody [NBP2-38907] - Staining of human rectum shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/EED-Antibody-Immunohistochemistry-Paraffin-NBP2-38907-img0008.jpg "Immunohistochemistry-Paraffin: EED Antibody [NBP2-38907] - Staining of human rectum shows moderate nuclear positivity in glandular cells.")
![Western Blot EZH2/KMT6 Antibody [Unconjugated]](https://images.novusbio.com/images2/EZH2_AF4767_Western_Blot_12571.jpg)
![Western Blot EZH2/KMT6 Antibody [Unconjugated]](https://images.novusbio.com/images/af4767_human-mouse-ezh2-affinity-purified-polyclonal-ab-4120241240516.jpg)
![Western Blot EZH2/KMT6 Antibody [Unconjugated]](https://images.novusbio.com/images/af4767_human-mouse-ezh2-affinity-purified-polyclonal-ab-4120241240219.jpg)
![Immunoprecipitation SUZ12 Antibody (448909) [Unconjugated]](https://images.novusbio.com/images2/SUZ12_MAB4184_Immunoprecipitation_15440.jpg)
![Western Blot SUZ12 Antibody (448909) [Unconjugated]](https://images.novusbio.com/images2/SUZ12_MAB4184_Western_Blot_12094.jpg)
![Immunocytochemistry SUZ12 Antibody (448909) [Unconjugated]](https://images.novusbio.com/images2/SUZ12_MAB4184_Immunocytochemistry__Immunofluorescence_20494.jpg)
![Immunohistochemistry CEACAM7 Antibody [Unconjugated]](https://images.novusbio.com/images2/CEACAM7_AF4478_Immunohistochemistry_20616.jpg)
![Western Blot CEACAM7 Antibody [Unconjugated]](https://images.novusbio.com/images2/CEACAM-7_AF4478_Western_Blot_5475.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")