![Immunocytochemistry/Immunofluorescence: NHS Antibody (6D9) [H00004810-M05] - Analysis of monoclonal antibody to NHS on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize/NHS-Antibody-6D9-Immunocytochemistry-Immunofluorescence-H00004810-M05-img0001.jpg "Immunocytochemistry/Immunofluorescence: NHS Antibody (6D9) [H00004810-M05] - Analysis of monoclonal antibody to NHS on HeLa cell. Antibody concentration 10 ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 6D9 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | NHS (NP_938011.1, 1532 a.a. ~ 1629 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TAESPQSTDDAHQGSQGAEALSPLSPCSPRVNAEGFSSKSFATSASARVGRSRAPPAASSSRYSVRCRLYNTPMQAISEGETENSDGSPHDDRSSQSS |
| Specificity | This product is specific for Human NHS monoclonal antibody (M05), clone 6D9 [Gene ID: 4810]. |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | NHS |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for NHS Antibody (H00004810-M05)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NHS |
| Uniprot |
|
![ELISA: NHS Antibody (6D9) [H00004810-M05] - Detection limit for recombinant GST tagged NHS is 0.03 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/NHS-Antibody-6D9-ELISA-H00004810-M05-img0003.jpg "ELISA: NHS Antibody (6D9) [H00004810-M05] - Detection limit for recombinant GST tagged NHS is 0.03 ng/ml as a capture antibody.")
![Western Blot EED Antibody [Unconjugated]](https://images.novusbio.com/images2/EED_AF5827_Western_Blot_5862.jpg)
![Complement Component C2 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Complement Component C2 Antibody [Unconjugated]")
![N/A Complement Component C5a [Biotin]](https://images.novusbio.com/images2/DATA_Complement_Component_C5a_DY2037_ELISA_1753.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_729.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_730.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/Kallikrein_3_DKK300_ELISA_124.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Immunohistochemistry Complement Factor H Antibody [Unconjugated]](https://images.novusbio.com/images2/Complement_Factor_H_AF4779_Immunohistochemistry_7182.jpg)
