Home » DNER » DNER Proteins » DNER Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

DNER Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for DNER Protein (NBP1-88665PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

DNER Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNER.

Source: E. coli

Amino Acid Sequence: GNASSNSSAGGRLVSFEVPQNTSVKIRQDATASLILLWKVTATGFQQCSLIDGRSVTPLQASGGLVLLEEMLALGNNHFIGFVNDSVTKSIVALRLTLVVKVSTCVPGESHANDLECSGKGKCTTKP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DNER
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88665.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DNER Recombinant Protein Antigen

  • bet
  • delta and Notch-like epidermal growth factor-related receptor
  • delta/notch-like EGF repeat containing
  • delta-notch-like EGF repeat-containing transmembrane
  • DNER
  • H_NH0150O02.1
  • UNQ26
  • WUGSC:H_NH0150O02.1

Background

DNER, also known as Delta and Notch-like epidermal growth factor-related receptor, is a 78.5 kDa, 737 amino acid protein and is involved in activating the NOTCH1 pathway. Current research is being conducted on diseases and disorders such as hepatitis, neuronitis and pathological gambling. The protein interacts with other proteins such as NOTCH1, APH1A, ZNF24, AP1G1, and DTX1 in Notch signaling pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CD8 Antibody
(53-6.7) - BSA Free
NBP1-49045
Immunohistochemistry-Paraffin CD8 Antibody (53-6.7) - BSA Free
Immunocytochemistry/ Immunofluorescence CD8 Antibody (53-6.7) - BSA Free
Immunohistochemistry-Frozen CD8 Antibody (53-6.7) - BSA Free
(3 Reviews)
(28 Publications)
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
SRPX Antibody -
BSA Free
NBP1-77086
Immunocytochemistry/ Immunofluorescence SRPX Antibody - BSA Free
Western Blot SRPX Antibody - BSA Free
Immunohistochemistry-Paraffin SRPX Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Pinin Antibody
NBP1-87784
Immunohistochemistry-Paraffin Pinin Antibody
Immunohistochemistry-Paraffin Pinin Antibody
Immunohistochemistry-Paraffin Pinin Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAL Antibody
(B5-G3)
NBP2-75563
Flow Cytometry MAL Antibody (B5-G3)
Immunohistochemistry-Paraffin MAL Antibody (B5-G3)
Immunohistochemistry-Paraffin MAL Antibody (B5-G3)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
TIRAP (TLR2 and
TLR4) Inhibitor Pepti ...
NBP2-26245
Other TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
Other TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
Other TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
(8 Publications)
Species: Hu, Mu
Applications: Flow, In vitro
Mkl1 Antibody
NBP1-88498
Immunohistochemistry-Paraffin Mkl1 Antibody
Immunohistochemistry-Paraffin Mkl1 Antibody
Immunohistochemistry-Paraffin Mkl1 Antibody
(8 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
BCR Antibody
AF5129
Western Blot BCR Antibody
(1 Publication)
Species: Hu
Applications: WB
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
PMEL17/SILV
Antibody (HMB45)
NBP2-44520
Flow (Intracellular) PMEL17/SILV Antibody (HMB45)
Flow (Intracellular) PMEL17/SILV Antibody (HMB45)
Immunohistochemistry PMEL17/SILV Antibody (HMB45)
(8 Publications)
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(301 Publications)
Species: Mu
Applications: ELISA
IL-5 [HRP]
M5000
N/A IL-5 [HRP]
N/A IL-5 [HRP]
(92 Publications)
Species: Mu
Applications: ELISA
BRD4 Antibody
(BL-149-2H5)
NBP2-76393
Immunocytochemistry/ Immunofluorescence BRD4 Antibody (BL-149-2H5)
Chromatin Immunoprecipitation Sequencing BRD4 Antibody (BL-149-2H5)
Immunoprecipitation BRD4 Antibody (BL-149-2H5)
Species: Hu, Mu
Applications: CHIP-SEQ, Flow, ICC/IF, IHC, IHC-P, IP, WB
Histatin 3
Antibody (4G9)
H00003347-M01
Sandwich ELISA Histatin 3 Antibody (4G9)
Immunocytochemistry/ Immunofluorescence Histatin 3 Antibody (4G9)
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
SI
Sucrase-Isomaltase An
NBP1-87581
Immunohistochemistry-Paraffin SI Sucrase-Isomaltase Antibody
Immunohistochemistry-Paraffin SI Sucrase-Isomaltase Antibody
Immunohistochemistry-Paraffin SI Sucrase-Isomaltase Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
HAI-2/SPINT2
Antibody [Unconjugate
AF1107
HAI-2/SPINT2 Antibody [Unconjugated]
(3 Publications)
Species: Mu
Applications: IHC, WB
Recombinant Human
ARSH GST (N-Term) Pro ...
H00347527-P01
Other Recombinant Human ARSH GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
GRB2 Antibody
[Unconjugated]
AF3846
Western Blot GRB2 Antibody [Unconjugated]
Immunohistochemistry GRB2 Antibody [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
CD55/DAF Antibody
[Unconjugated]
AF2009
Immunohistochemistry CD55/DAF Antibody [Unconjugated]
Immunocytochemistry CD55/DAF Antibody [Unconjugated]
(8 Publications)
Species: Hu
Applications: ICC, IHC
DNER Recombinant
Protein Antigen
NBP1-88665PEP
DNER Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for DNER Protein (NBP1-88665PEP) (0)

There are no publications for DNER Protein (NBP1-88665PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNER Protein (NBP1-88665PEP) (0)

There are no reviews for DNER Protein (NBP1-88665PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DNER Protein (NBP1-88665PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DNER Products

Research Areas for DNER Protein (NBP1-88665PEP)

Find related products by research area.

Blogs on DNER

There are no specific blogs for DNER, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DNER Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol DNER