![Western Blot: Mkl1 Antibody [NBP1-88498] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/Mkl1-Antibody-Western-Blot-NBP1-88498-img0010.jpg "Western Blot: Mkl1 Antibody [NBP1-88498] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EQEKRAQQPAPAPAPLGTPVKQENSFSSCQLSQQPLGPAHPFNPSLAAPATNHIDPCAVAPGPPSVVVKQEALQPEPEPVPAPQLLLGPQGPSLIKGVAPPTLITDSTGTHLVLTVTNKNADSPG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MRTFA |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Mkl1 Antibody (NBP1-88498)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Mkl1 Antibody [NBP1-88498] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Mkl1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88498-img0008.jpg "Immunocytochemistry/Immunofluorescence: Mkl1 Antibody [NBP1-88498] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Mkl1 Antibody [NBP1-88498] - Staining of human testis shows positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Mkl1-Antibody-Immunohistochemistry-Paraffin-NBP1-88498-img0018.jpg "Immunohistochemistry-Paraffin: Mkl1 Antibody [NBP1-88498] - Staining of human testis shows positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: Mkl1 Antibody [NBP1-88498] - Staining of human liver shows very weak positivity in hepatocytes.](http://images.novusbio.com/fullsize/Mkl1-Antibody-Immunohistochemistry-Paraffin-NBP1-88498-img0015.jpg "Immunohistochemistry-Paraffin: Mkl1 Antibody [NBP1-88498] - Staining of human liver shows very weak positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: Mkl1 Antibody [NBP1-88498] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.](http://images.novusbio.com/fullsize/Mkl1-Antibody-Immunohistochemistry-Paraffin-NBP1-88498-img0016.jpg "Immunohistochemistry-Paraffin: Mkl1 Antibody [NBP1-88498] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.")
![Immunohistochemistry-Paraffin: Mkl1 Antibody [NBP1-88498] - Staining of human lymph node shows moderate positivity in lymphoid cells.](http://images.novusbio.com/fullsize/Mkl1-Antibody-Immunohistochemistry-Paraffin-NBP1-88498-img0017.jpg "Immunohistochemistry-Paraffin: Mkl1 Antibody [NBP1-88498] - Staining of human lymph node shows moderate positivity in lymphoid cells.")
![Western Blot Myocardin Antibody (355521) [Unconjugated]](https://images.novusbio.com/images2/Myocardin_MAB4028_Western_Blot_6147.jpg)
![Western Blot Myocardin Antibody (355521) [Unconjugated]](https://images.novusbio.com/images/mab4028_human-mouse-myocardin-mab-clone-355521-412024125217.jpg)
![Western Blot Myocardin Antibody (355521) [Unconjugated]](https://images.novusbio.com/images/mab4028_human-mouse-myocardin-mab-clone-355521-41202412505317.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunohistochemistry DNER Antibody [Unconjugated]](https://images.novusbio.com/images2/DNER_AF2254_Immunohistochemistry_18506.jpg)
![Immunocytochemistry/ Immunofluorescence DNER Antibody [Unconjugated]](https://images.novusbio.com/images/af2254_mouse-dner-affinity-purified-polyclonal-ab-41202412394943.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")