![Western Blot: Pinin Antibody [NBP1-87784] - Analysis in human cell line HepG2.](http://images.novusbio.com/fullsize/Pinin-Antibody-Western-Blot-NBP1-87784-img0006.jpg "Western Blot: Pinin Antibody [NBP1-87784] - Analysis in human cell line HepG2.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EQKVELAQLQEEWNEHNAKIIKYIRTKTKPHLFYIPGRMCPATQKLIEESQRKMNALFEGRRIEFAEQINKMEARPRRQSMKEKEHQVVRNEEQKAEQEEGKVAQREEELEETGNQHNDVEIEEAGEEEEKEIAIVHSDAEKE |
| Predicted Species | Mouse (98%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PNN |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Myoglobin Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Myoglobin Antibody [Unconjugated]")
![Western Blot Myeloperoxidase/MPO Antibody [Unconjugated]](https://images.novusbio.com/images2/Myeloperoxidase_AF3667_Western_Blot_5321.jpg)
![Simple Western Myeloperoxidase/MPO Antibody [Unconjugated]](https://images.novusbio.com/images2/Myeloperoxidase_AF3667_Simple_Western_16637.jpg)
![Immunocytochemistry Myeloperoxidase/MPO Antibody [Unconjugated]](https://images.novusbio.com/images2/Myeloperoxidase_AF3667_Immunocytochemistry__Immunofluorescence_17390.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PNN |
![Immunocytochemistry/Immunofluorescence: Pinin Antibody [NBP1-87784] - Staining of human cell line A-431 shows localization to nuclear speckles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Pinin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87784-img0007.jpg "Immunocytochemistry/Immunofluorescence: Pinin Antibody [NBP1-87784] - Staining of human cell line A-431 shows localization to nuclear speckles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Pinin Antibody [NBP1-87784] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.](http://images.novusbio.com/fullsize/Pinin-Antibody-Immunohistochemistry-Paraffin-NBP1-87784-img0011.jpg "Immunohistochemistry-Paraffin: Pinin Antibody [NBP1-87784] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.")
![Immunohistochemistry-Paraffin: Pinin Antibody [NBP1-87784] - Staining of human small intestine shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/Pinin-Antibody-Immunohistochemistry-Paraffin-NBP1-87784-img0008.jpg "Immunohistochemistry-Paraffin: Pinin Antibody [NBP1-87784] - Staining of human small intestine shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Pinin Antibody [NBP1-87784] - Staining of human tonsil shows strong nuclear positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/Pinin-Antibody-Immunohistochemistry-Paraffin-NBP1-87784-img0009.jpg "Immunohistochemistry-Paraffin: Pinin Antibody [NBP1-87784] - Staining of human tonsil shows strong nuclear positivity in non-germinal center cells.")
![Immunohistochemistry-Paraffin: Pinin Antibody [NBP1-87784] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/Pinin-Antibody-Immunohistochemistry-Paraffin-NBP1-87784-img0010.jpg "Immunohistochemistry-Paraffin: Pinin Antibody [NBP1-87784] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Immunohistochemistry DNER Antibody [Unconjugated]](https://images.novusbio.com/images2/DNER_AF2254_Immunohistochemistry_18506.jpg)
![Immunocytochemistry/ Immunofluorescence DNER Antibody [Unconjugated]](https://images.novusbio.com/images/af2254_mouse-dner-affinity-purified-polyclonal-ab-41202412394943.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A SHBG [HRP]](https://images.novusbio.com/images2/SHBG_DSHBG0_ELISA_1106.jpg)
![N/A SHBG [HRP]](https://images.novusbio.com/images2/SHBG_DSHBG0_ELISA_1107.jpg)
![N/A SHBG [HRP]](https://images.novusbio.com/images2/SHBG_DSHBG0_ELISA_2581.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")