![Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166] - Staining in human cervix, uterine and skeletal muscle tissues.. Corresponding KRT13 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Cytokeratin-13-Antibody-Immunohistochemistry-Paraffin-NBP2-38166-img0017.jpg "Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166] - Staining in human cervix, uterine and skeletal muscle tissues.. Corresponding KRT13 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MSLRLQSSSASYGGGFGGGSCQLGGGRGVSTCSTRFVSGGSAGGYGGGVSCG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KRT13 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Choline Kinase beta [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Choline Kinase beta [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Research Areas for Cytokeratin 13 Antibody (NBP2-38166)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: Cytokeratin 13 Antibody [NBP2-38166] - Analysis in human cell lines A-431 and HEK293 using anti-KRT13 antibody. Corresponding KRT13 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.](http://images.novusbio.com/fullsize/Cytokeratin-13-Antibody-Western-Blot-NBP2-38166-img0012.jpg "Western Blot: Cytokeratin 13 Antibody [NBP2-38166] - Analysis in human cell lines A-431 and HEK293 using anti-KRT13 antibody. Corresponding KRT13 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.")
![Immunocytochemistry/Immunofluorescence: Cytokeratin 13 Antibody [NBP2-38166] - Staining of human cell line A-431 shows localization to intermediate filaments. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Cytokeratin-13-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38166-img0004.jpg "Immunocytochemistry/Immunofluorescence: Cytokeratin 13 Antibody [NBP2-38166] - Staining of human cell line A-431 shows localization to intermediate filaments. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166] - Staining of human prostate shows positivity in the basal layer.](http://images.novusbio.com/fullsize/Cytokeratin-13-Antibody-Immunohistochemistry-Paraffin-NBP2-38166-img0013.jpg "Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166] - Staining of human prostate shows positivity in the basal layer.")
![Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166] - Staining of human skin shows positivity in epidermal cells.](http://images.novusbio.com/fullsize/Cytokeratin-13-Antibody-Immunohistochemistry-Paraffin-NBP2-38166-img0014.jpg "Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166] - Staining of human skin shows positivity in epidermal cells.")
![Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166] - Staining of human cervix shows positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/Cytokeratin-13-Antibody-Immunohistochemistry-Paraffin-NBP2-38166-img0015.jpg "Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166] - Staining of human cervix shows positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/Cytokeratin-13-Antibody-Immunohistochemistry-Paraffin-NBP2-38166-img0016.jpg "Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Simple Western Cytokeratin 18 Antibody (810811) [Unconjugated]](https://images.novusbio.com/images2/16390.jpg)
![Western Blot Cytokeratin 18 Antibody (810811) [Unconjugated]](https://images.novusbio.com/images2/Cytokeratin_18_MAB7619_Western_Blot_12720.jpg)
![Immunocytochemistry Cytokeratin 18 Antibody (810811) [Unconjugated]](https://images.novusbio.com/images2/Cytokeratin_18_MAB7619_Immunocytochemistry_12734.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")