Reactivity | HuSpecies Glossary |
Applications | WB, ELISA, MA, AP |
Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-36 of Human CX3CR1 Source: Wheat Germ (in vitro) Amino Acid Sequence: MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSI |
Preparation Method |
in vitro wheat germ expression system |
Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
Source | Wheat germ |
Protein/Peptide Type | Recombinant Protein |
Gene | CX3CR1 |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Dilutions |
|
Theoretical MW | 29.7 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at -80C. Avoid freeze-thaw cycles. |
Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Preservative | No Preservative |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for CX3CR1 Partial Recombinant Protein (H00001524-Q01)Find related products by research area.
|
TMEM 119 is a specific marker of microglia cells By Jennifer Sokolowski, MD, PhD.Microglia are a major immune-cell component in the brain. They ingest and degrade dead cells, debris, and foreign material and interact with other immune cells to orchestrate centra... Read full blog post. |
New Study Links Tau Mutations to Microglial Immune Response Tau proteins are abundant in the axons of neurons in the central nervous system (CNS), and play a key role in microtubule formation and stabilization. Antibody studies have identified six tau isoforms, all produced by alternative mRNA splicing of the ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | CX3CR1 |