![Western Blot: CTCF Antibody (4W9B0) [NBP3-15795] - Western blot analysis of extracts of various cell lines, using CTCF antibody (NBP3-15795) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.](http://images.novusbio.com/fullsize/CTCF-Antibody-4W9B0-Western-Blot-NBP3-15795-img0003.jpg "Western Blot: CTCF Antibody (4W9B0) [NBP3-15795] - Western blot analysis of extracts of various cell lines, using CTCF antibody (NBP3-15795) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IP, ChIP |
| Clone | 4W9B0 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 628-727 of human CTCF (P49711). PAVEIEPEPEPQPVTPAPPPAKKRRGRPPGRTNQPKQNQPTAIIQVEDQNTGAIENIIVEVKKEPDAEPAEGEEEEAQPAATDAPNGDLTPEMILSMMDR |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | CTCF |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CTCF Antibody (NBP3-15795)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CTCF |
![Immunocytochemistry/Immunofluorescence: CTCF Antibody (4W9B0) [NBP3-15795] - Immunofluorescence analysis of NIH-3T3 cells using CTCF antibody (NBP3-15795). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/CTCF-Antibody-4W9B0-Immunocytochemistry-Immunofluorescence-NBP3-15795-img0002.jpg "Immunocytochemistry/Immunofluorescence: CTCF Antibody (4W9B0) [NBP3-15795] - Immunofluorescence analysis of NIH-3T3 cells using CTCF antibody (NBP3-15795). Blue: DAPI for nuclear staining.")
![Chromatin Immunoprecipitation: CTCF Antibody (4W9B0) [NBP3-15795] - Chromatin immunoprecipitation analysis of extracts of 293T cells, using CTCF antibody (NBP3-15795) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.](http://images.novusbio.com/fullsize/CTCF-Antibody-4W9B0-Chromatin-Immunoprecipitation-NBP3-15795-img0005.jpg "Chromatin Immunoprecipitation: CTCF Antibody (4W9B0) [NBP3-15795] - Chromatin immunoprecipitation analysis of extracts of 293T cells, using CTCF antibody (NBP3-15795) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.")
![Immunocytochemistry/Immunofluorescence: CTCF Antibody (4W9B0) [NBP3-15795] - Immunofluorescence analysis of C6 cells using CTCF antibody (NBP3-15795). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/CTCF-Antibody-4W9B0-Immunocytochemistry-Immunofluorescence-NBP3-15795-img0001.jpg "Immunocytochemistry/Immunofluorescence: CTCF Antibody (4W9B0) [NBP3-15795] - Immunofluorescence analysis of C6 cells using CTCF antibody (NBP3-15795). Blue: DAPI for nuclear staining.")
![Immunoprecipitation: CTCF Antibody (4W9B0) [NBP3-15795] - Immunoprecipitation analysis of 300ug extracts of 293T cells using 3ug CTCF antibody (NBP3-15795). Western blot was performed from the immunoprecipitate using CTCF antibody (NBP3-15795) at a dilition of 1:1000.](http://images.novusbio.com/fullsize/CTCF-Antibody-4W9B0-Immunoprecipitation-NBP3-15795-img0004.jpg "Immunoprecipitation: CTCF Antibody (4W9B0) [NBP3-15795] - Immunoprecipitation analysis of 300ug extracts of 293T cells using 3ug CTCF antibody (NBP3-15795). Western blot was performed from the immunoprecipitate using CTCF antibody (NBP3-15795) at a dilition of 1:1000.")
![SDS-PAGE IGF-II/IGF2 [Unconjugated]](https://images.novusbio.com/images2/IGF-II_292-G2_668.jpg)
![Bioactivity IGF-II/IGF2 [Unconjugated]](https://images.novusbio.com/images2/IGF-II_292-G2_669.jpg)
![Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Chromatin_Immunoprecipitation_11218.jpg)
![Immunocytochemistry Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Immunocytochemistry_7093.jpg)
![Simple Western Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct3_4_AF1759_Simple_Western_20183.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")