CRM1 Antibody (1J0L10) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 972-1071 of human CRM1 (O14980). IFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
XPO1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS, 0.05% BSA, 50% glycerol, pH7.3 |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for CRM1 Antibody (1J0L10)
Background
Official Gene Symbol: XPO1 Gen Bank Accession Number: NP_003391 Gene ID: 7514 (human) Gene Map Locus: 2p16 (human) Nuclear transport receptors of karyopherin/importin-beta superfamily mediate various transport pathways between nucleus and cytoplasm. Exportin-1, a human homolog of yeast CRM1, is a novel karyopherin export receptor that mediates leucine-rich NES-dependent protein export. It interacts with RanGTP through its Ran-binding domain and also with nucleoporins including Nup214, Nup50, Nup42 and Nup159 during the process of exporting NES-containing proteins. It mediates the export of many cellular and viral proteins and ribonucleoproteins including HIV Rev Protein, ERK3, PKI, IRF-5, Cyclin-B, MAPKK, MAPKAP kinase 2, Snurportin, Cap-binding protein, and certain U snRNAs. Reports suggest exportin-1 also has a role in the regulation of NFAT and AP-1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, KO, WB
Species: Hu
Applications: WB
Species: Bv, Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Publications for CRM1 Antibody (NBP3-15823) (0)
There are no publications for CRM1 Antibody (NBP3-15823).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CRM1 Antibody (NBP3-15823) (0)
There are no reviews for CRM1 Antibody (NBP3-15823).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CRM1 Antibody (NBP3-15823) (0)