Home » CMAS » CMAS Proteins » CMAS Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CMAS Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CMAS Protein (NBP1-85858PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CMAS Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CMAS.

Source: E. coli

Amino Acid Sequence: KMEVSVSDKLAVVDEWRKEMGLCWKEVAYLGNEVSDEECLKRVGLSGAPADACSTAQKAVGYICKCNGGRGAIREFAEHICLLMEKVNNSCQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CMAS
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85858.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CMAS Recombinant Protein Antigen

  • CMP-N-acetylneuraminic acid synthase
  • CMP-N-acetylneuraminic acid synthetase
  • CMP-Neu5Ac synthetase
  • CMP-NeuNAc synthase
  • CMP-NeuNAc synthetase
  • cytidine 5'-monophosphate N-acetylneuraminic acid synthetase
  • cytidine monophosphate N-acetylneuraminic acid synthetase
  • EC 2.7.7.43
  • N-acylneuraminate cytidylyltransferase

Background

The enzyme encoded by this gene catalyzes the activation of Neu5Ac to Cytidine 5-prime-monophosphate N-acetylneuraminic acid (CMP-Neu5Ac), which provides the substrate required for the addition of sialic acid. Sialic acids of cell surface glycoproteins and glycolipids play a pivotal role in the structure and function of animal tissues. The pattern of cell surface sialylation is highly regulated during embryonic development, and changes with stages of differentiation. Studies of a similar murine protein suggest that this protein localizes to the nucleus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Kallikrein 3/PSA
[HRP]
DKK300
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
(17 Publications)
Species: Hu
Applications: ELISA
MID1 Antibody -
BSA Free
NBP3-05061
Immunocytochemistry/ Immunofluorescence MID1 Antibody - BSA Free
Western Blot MID1 Antibody - BSA Free
Species: Hu, Mu
Applications: ICC/IF, WB
SLC25A1 Antibody
NBP1-31851
Western Blot SLC25A1 Antibody
Western Blot SLC25A1 Antibody
Western Blot SLC25A1 Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
PSAT1 Antibody
NBP1-32920
Western Blot PSAT1 Antibody
Immunocytochemistry/ Immunofluorescence PSAT1 Antibody
Immunohistochemistry-Paraffin PSAT1 Antibody
(12 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Protein S/PROS1
Antibody [Unconjugate
AF4036
Western Blot Protein S/PROS1 Antibody [Unconjugated]
Simple Western Protein S/PROS1 Antibody [Unconjugated]
(7 Publications)
Species: Hu
Applications: Simple Western, WB
PLAG1 Antibody
(3B7)
H00005324-M02
Immunohistochemistry PLAG1 Antibody (3B7)
Immunohistochemistry PLAG1 Antibody (3B7)
ELISA PLAG1 Antibody (3B7)
(20 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB

Puromycin-sensitive am ...
NBP2-13669
Immunohistochemistry-Paraffin Puromycin-sensitive aminopeptidase/NPEPPS Antibody
Immunohistochemistry Puromycin-sensitive aminopeptidase/NPEPPS Antibody
Immunohistochemistry-Paraffin Puromycin-sensitive aminopeptidase/NPEPPS Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Cytokeratin, pan
Antibody (AE-1/AE-3)
NBP2-29429
Dual RNAscope ISH-IHC Cytokeratin, pan Antibody (AE-1/AE-3)
CyTOF-reported Cytokeratin, pan Antibody (AE-1/AE-3)
Flow Cytometry Cytokeratin, pan Antibody (AE-1/AE-3)
(1 Review)
(67 Publications)
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, mIF, Single-Cell Western, WB
Proteinase
3/Myeloblastin/PRTN3 ...
NBP1-25966
Western Blot Proteinase 3/Myeloblastin/PRTN3 Antibody
Immunocytochemistry/ Immunofluorescence Proteinase 3/Myeloblastin/PRTN3 Antibody
Immunocytochemistry/ Immunofluorescence Proteinase 3/Myeloblastin/PRTN3 Antibody
(2 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
POMT1 Antibody
NBP3-12487
Immunohistochemistry-Paraffin POMT1 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB

Myeloperoxidase/MPO An ...
AF3667
Western Blot Myeloperoxidase/MPO Antibody [Unconjugated]
Simple Western Myeloperoxidase/MPO Antibody [Unconjugated]
Immunocytochemistry Myeloperoxidase/MPO Antibody [Unconjugated]
(3 Reviews)
(167 Publications)
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
Adenine Nucleotide
Translocator 2 Antibo ...
NBP2-92630
Immunocytochemistry/ Immunofluorescence Adenine Nucleotide Translocator 2 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin Adenine Nucleotide Translocator 2 Antibody - Azide and BSA Free
Western Blot Adenine Nucleotide Translocator 2 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NANS Antibody
NBP1-87088
Western Blot NANS Antibody
Immunohistochemistry-Paraffin NANS Antibody
Western Blot NANS Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ACAT1 Antibody
NBP1-89284
Western Blot ACAT1 Antibody
Immunocytochemistry/ Immunofluorescence ACAT1 Antibody
Immunohistochemistry-Paraffin ACAT1 Antibody
(1 Review)
(5 Publications)
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, KD, WB
APC Antibody - BSA
Free
NB100-91662
Immunocytochemistry/ Immunofluorescence APC Antibody - BSA Free
Flow Cytometry APC Antibody - BSA Free
Immunohistochemistry-Paraffin APC Antibody - BSA Free
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Regucalcin Antibody
NBP1-80849
Western Blot Regucalcin Antibody
Immunohistochemistry-Paraffin Regucalcin Antibody
Immunohistochemistry-Paraffin Regucalcin Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Glutamine
Synthetase Antibody
NB110-41404
Immunocytochemistry/ Immunofluorescence Glutamine Synthetase Antibody
Western Blot Glutamine Synthetase Antibody
Immunohistochemistry Glutamine Synthetase Antibody
(1 Review)
(11 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
CMAS Recombinant
Protein Antigen
NBP1-85858PEP
CMAS Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for CMAS Protein (NBP1-85858PEP) (0)

There are no publications for CMAS Protein (NBP1-85858PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CMAS Protein (NBP1-85858PEP) (0)

There are no reviews for CMAS Protein (NBP1-85858PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CMAS Protein (NBP1-85858PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CMAS Products

Research Areas for CMAS Protein (NBP1-85858PEP)

Find related products by research area.

Blogs on CMAS

There are no specific blogs for CMAS, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Western blot shows lysates of HL-60 human acute promyelocytic leukemia cell line, human neutrophil cells, and mouse spleen tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse Myeloperoxidase/MPO Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3667) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (HAF019). A specific band was detected for Myeloperoxidase/MPO at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Myeloperoxidase/MPO Antibody [Unconjugated]
AF3667

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CMAS Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CMAS