![Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Analysis in human adrenal gland and tonsil tissues using NBP1-80849 antibody. Corresponding RGN RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Regucalcin-Antibody-Immunohistochemistry-Paraffin-NBP1-80849-img0024.jpg "Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Analysis in human adrenal gland and tonsil tissues using NBP1-80849 antibody. Corresponding RGN RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSY |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RGN |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Regucalcin Antibody (NBP1-80849)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human adrenal gland, kidney, liver and tonsil using Anti-RGN antibody NBP1-80849 (A) shows similar protein distribution across tissues to independent antibody NBP1-80850 (B).](http://images.novusbio.com/fullsize/Regucalcin-Antibody-Immunohistochemistry-Paraffin-NBP1-80849-img0023.jpg "Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human adrenal gland, kidney, liver and tonsil using Anti-RGN antibody NBP1-80849 (A) shows similar protein distribution across tissues to independent antibody NBP1-80850 (B).")
![Western Blot: Regucalcin Antibody [NBP1-80849] - Analysis using Anti-RGN antibody NBP1-80849 (A) shows similar pattern to independent antibody NBP1-80850 (B).](http://images.novusbio.com/fullsize/Regucalcin-Antibody-Western-Blot-NBP1-80849-img0019.jpg "Western Blot: Regucalcin Antibody [NBP1-80849] - Analysis using Anti-RGN antibody NBP1-80849 (A) shows similar pattern to independent antibody NBP1-80850 (B).")
![Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/Regucalcin-Antibody-Immunohistochemistry-Paraffin-NBP1-80849-img0027.jpg "Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.")
![Western Blot: Regucalcin Antibody [NBP1-80849] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate. Recommended dilution: 1:250 - 1:500](http://images.novusbio.com/fullsize/Regucalcin-Antibody-Western-Blot-NBP1-80849-img0004.jpg "Western Blot: Regucalcin Antibody [NBP1-80849] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate. Recommended dilution: 1:250 - 1:500")
![Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human adrenal gland shows strong positivity in glandular cells.](http://images.novusbio.com/fullsize/Regucalcin-Antibody-Immunohistochemistry-Paraffin-NBP1-80849-img0025.jpg "Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human adrenal gland shows strong positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human liver shows strong positivity in hepatocytes.](http://images.novusbio.com/fullsize/Regucalcin-Antibody-Immunohistochemistry-Paraffin-NBP1-80849-img0026.jpg "Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human liver shows strong positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.](http://images.novusbio.com/fullsize/Regucalcin-Antibody-Immunohistochemistry-Paraffin-NBP1-80849-img0028.jpg "Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.")
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")