![Immunohistochemistry-Paraffin: Cingulin Antibody [NBP1-89600] - Staining in human small intestine and lymph node tissues using anti-CGN antibody. Corresponding CGN RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Cingulin-Antibody-Immunohistochemistry-Paraffin-NBP1-89600-img0011.jpg "Immunohistochemistry-Paraffin: Cingulin Antibody [NBP1-89600] - Staining in human small intestine and lymph node tissues using anti-CGN antibody. Corresponding CGN RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DSKQALQQLQAQLEDYKEKARREVADAQRQAKDWASEAEKTSGGLSRLQDEIQRLRQALQASQAERDTARLDKELLAQRLQGLEQEAENKKRSQDDRARQLKGLEE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CGN |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunohistochemistry-Frozen reported in scientific literature (PMID: 31719823). |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
![Bioactivity C1QL1 [Unconjugated]](https://images.novusbio.com/images2/C1qL1_9134TN_1238.jpg)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
![Neutralization CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Block_Neutralize_9064.jpg)
![Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Immunocytochemistry_9339.jpg)
![Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/mab208_human-il-8-cxcl8-mab-clone-6217-western-blot-1882021143847.jpg)
| Publication using NBP1-89600 | Applications | Species |
|---|---|---|
| Wu D, Ding L, Tang X et al. Baicalin Protects Against Hypertension-Associated Intestinal Barrier Impairment in Part Through Enhanced Microbial Production of Short-Chain Fatty Acids Front Pharmacol 2019-10-28 [PMID: 31719823] (IHC-Fr, Rat) | IHC-Fr | Rat |
Secondary Antibodies |
Isotype Controls |
Research Areas for Cingulin Antibody (NBP1-89600)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CGN |
![Western Blot: Cingulin Antibody [NBP1-89600] - Analysis using Anti-CGN antibody NBP1-89600 (A) shows similar pattern to independent antibody NBP1-89602 (B).](http://images.novusbio.com/fullsize/Cingulin-Antibody-Western-Blot-NBP1-89600-img0013.jpg "Western Blot: Cingulin Antibody [NBP1-89600] - Analysis using Anti-CGN antibody NBP1-89600 (A) shows similar pattern to independent antibody NBP1-89602 (B).")
![Western Blot: Cingulin Antibody [NBP1-89600] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/Cingulin-Antibody-Western-Blot-NBP1-89600-img0008.jpg "Western Blot: Cingulin Antibody [NBP1-89600] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Western Blot: Cingulin Antibody [NBP1-89600] - Analysis in human cell lines Caco-2 and HeLa using Anti-CGN antibody. Corresponding CGN RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/Cingulin-Antibody-Western-Blot-NBP1-89600-img0012.jpg "Western Blot: Cingulin Antibody [NBP1-89600] - Analysis in human cell lines Caco-2 and HeLa using Anti-CGN antibody. Corresponding CGN RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.")
![Immunohistochemistry-Paraffin: Cingulin Antibody [NBP1-89600] - Staining of human lymph node shows low expression as expected.](http://images.novusbio.com/fullsize/Cingulin-Antibody-Immunohistochemistry-Paraffin-NBP1-89600-img0009.jpg "Immunohistochemistry-Paraffin: Cingulin Antibody [NBP1-89600] - Staining of human lymph node shows low expression as expected.")
![Immunohistochemistry-Paraffin: Cingulin Antibody [NBP1-89600] - Staining of human small intestine shows high expression.](http://images.novusbio.com/fullsize/Cingulin-Antibody-Immunohistochemistry-Paraffin-NBP1-89600-img0010.jpg "Immunohistochemistry-Paraffin: Cingulin Antibody [NBP1-89600] - Staining of human small intestine shows high expression.")
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunocytochemistry Nucleostemin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nucleostemin_AF1638_Immunocytochemistry_6472.jpg)
![Simple Western Nucleostemin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nucleostemin_AF1638_Simple_Western_18959.jpg)
![Western Blot Nucleostemin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nucleostemin_AF1638_Western_Blot_18960.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")