![Immunocytochemistry/Immunofluorescence: TJP3 Antibody [NBP2-38696] - Staining of human cell line CACO-2 shows positivity in cell junctions and nucleus but excluded from the nucleoli.](http://images.novusbio.com/fullsize/TJP3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38696-img0001.jpg "Immunocytochemistry/Immunofluorescence: TJP3 Antibody [NBP2-38696] - Staining of human cell line CACO-2 shows positivity in cell junctions and nucleus but excluded from the nucleoli.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VMVNGVSMENATSAFAIQILKTCTKMANITVKRPRRIHLPATKASPSSPGRQDSDEDDGPQRVEEVDQGRGYDGDSSSGS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TJP3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696] - Staining of human Small intestine shows strong membranous and cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/TJP3-Antibody-Immunohistochemistry-Paraffin-NBP2-38696-img0009.jpg "Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696] - Staining of human Small intestine shows strong membranous and cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696] - Staining of human fallopian tube shows moderate cell membrane positivity in glandular cells.](http://images.novusbio.com/fullsize/TJP3-Antibody-Immunohistochemistry-Paraffin-NBP2-38696-img0003.jpg "Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696] - Staining of human fallopian tube shows moderate cell membrane positivity in glandular cells.")
![Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696] - Staining of human prostate shows low expression as expected.](http://images.novusbio.com/fullsize/TJP3-Antibody-Immunohistochemistry-Paraffin-NBP2-38696-img0004.jpg "Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696] - Staining of human prostate shows low expression as expected.")
![Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696] - Staining in human fallopian tube and prostate tissues using anti-TJP3 antibody. Corresponding TJP3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/TJP3-Antibody-Immunohistochemistry-Paraffin-NBP2-38696-img0005.jpg "Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696] - Staining in human fallopian tube and prostate tissues using anti-TJP3 antibody. Corresponding TJP3 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696] - Analysis in human small intestine and cerebral cortex tissues using NBP2-38696 antibody. Corresponding TJP3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/TJP3-Antibody-Immunohistochemistry-Paraffin-NBP2-38696-img0006.jpg "Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696] - Analysis in human small intestine and cerebral cortex tissues using NBP2-38696 antibody. Corresponding TJP3 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696] - Staining of human Cerebral cortex shows very weak membranous positivity in neuronal cells.](http://images.novusbio.com/fullsize/TJP3-Antibody-Immunohistochemistry-Paraffin-NBP2-38696-img0007.jpg "Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696] - Staining of human Cerebral cortex shows very weak membranous positivity in neuronal cells.")
![Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696] - Staining of human Endometrium shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/TJP3-Antibody-Immunohistochemistry-Paraffin-NBP2-38696-img0008.jpg "Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696] - Staining of human Endometrium shows strong membranous positivity in glandular cells.")
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")